Property Summary

NCBI Gene PubMed Count 95
Grant Count 19
R01 Count 11
Funding $2,449,768.18
PubMed Score 21.44
PubTator Score 141.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (67)

PMID Text
26975699 Results indicate that overexpression of S100P is related with an invasive and metastatic phenotype of CRC which is EMT-involved and RAGE dependent.
26797416 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26551460 The highly specific IL-11 - S100P interaction occurring under physiologically relevant conditions should be taken into consideration upon development of the antineoplastics inhibiting IL-11 signaling.
26320193 Data indicate that S100 calcium binding protein P (S100P) increased lung cancer cell migration by binding integrin alpha7.
26291820 S100P in first trimester placenta was significantly less in spontaneous abortion patients than in normal pregnant women. Up-regulation of S100P in JAR cells promoted JAR cells proliferation, and increased the expression of p38 MAPK and pERK MAPK
26276712 t-S100P, 9.2-kDa C-terminally truncated form of S100P, is the predominant form of S100P in breast cancer tissue and is strongly prognostic for disease-free survival in women with lymph node-positive disease.
26193421 S100P/RAGE signaling pathway regulates expression of microRNA-21 in colon cancer cells
26125892 S100P expression in prostate cancer tissue was significantly decreased, whereas CD147 and OCT4 expression was increased. Their expression levels were closely associated with TNM stage and distant metastasis.
26112095 High expression of S100P and HYAL2 is significantly associated with advanced disease and shorter survival of triple-negative breast cancer and S100P and HYAL2 could be potential prognostic markers of TNBC.
26078391 Keap1 functions as a suppressor of tumor metastasis by targeting the Nrf2/S100P pathway in NSCLC cells.
More...

AA Sequence

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD      1 - 70
FSEFIVFVAAITSACHKYFEKAGLK                                                  71 - 95
//

Text Mined References (97)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26975699 2016 Analysis of the predictive efficiency of S100P on adverse prognosis and the pathogenesis of S100P-mediated invasion and metastasis of colon adenocarcinoma.
26797416 2016 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26551460 2015 High-affinity interaction between interleukin-11 and S100P protein.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26320193 2015 S100P interacts with integrin ?7 and increases cancer cell migration and invasion in lung cancer.
26291820 2015 S100P regulates trophoblast-like cell proliferation via P38 MAPK pathway.
26276712 2015 A novel truncated form of S100P predicts disease-free survival in patients with lymph node positive breast cancer.
26193421 2015 The S100P/RAGE signaling pathway regulates expression of microRNA-21 in colon cancer cells.
26125892 2015 Expression and significance of S100P, CD147, and OCT4 in different prostate cancer tissue TNM stages.
More...