Property Summary

NCBI Gene PubMed Count 40
Grant Count 17
R01 Count 10
Funding $1,361,738.49
PubMed Score 32.83
PubTator Score 28.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (12)

PMID Text
26560027 a polymorphism within a super-enhancer element in the first intron of LMO1 influences neuroblastoma susceptibility through differential GATA transcription factor binding and direct modulation of LMO1 expression in cis
26459575 LMO1 appears to be a coactivator of AR involved in the progression of prostate cancer
26030754 data suggest that genetic variants in LMO1 are associated with increased NB risk in Chinese children.
25037573 LMO1 is a commonly activated tumor promoter that activates AKT signaling in non-small cell lung cancer.
24845030 LMO1 is a commonly activated tumor promoter that activates AKT signaling in colorectal cancer and a new predictive marker for targeted therapy.
23302769 results show that LMO1 is poised for expression in normal progenitors, where activation of SCL/TAL1 together with a breakdown of epigenetic repression of LMO1 regulatory elements
21602560 genetic variants within LMO1 are associated with acute lymphoblastic leukemia and identify this gene as a strong candidate for precursor B-cell leukemogenesis.
21124317 data show that common polymorphisms at the LMO1 locus are strongly associated with susceptibility to developing neuroblastoma, but also may influence the likelihood of further somatic alterations at this locus, leading to malignant progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN      1 - 70
LILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQM     71 - 140
DYEEGQLNGTFESQVQ                                                          141 - 156
//

Text Mined References (41)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26560027 2015 Genetic predisposition to neuroblastoma mediated by a LMO1 super-enhancer polymorphism.
26459575 2015 Upregulated LMO1 in prostate cancer acts as a novel coactivator of the androgen receptor.
26030754 2015 Candidate Gene Association Analysis of Neuroblastoma in Chinese Children Strengthens the Role of LMO1.
25416956 2014 A proteome-scale map of the human interactome network.
25037573 2014 LMO1 is a novel oncogene in lung cancer, and its overexpression is a new predictive marker for anti-EGFR therapy.
24845030 2014 LMO1 is a novel oncogene in colorectal cancer and its overexpression is a new predictive marker for anti-EGFR therapy.
24379077 2014 LIM-domain-only proteins: multifunctional nuclear transcription coregulators that interacts with diverse proteins.
23743675 2013 A meta-analysis of two genome-wide association studies to identify novel loci for maximum number of alcoholic drinks.
23302769 2013 Bivalent promoter marks and a latent enhancer may prime the leukaemia oncogene LMO1 for ectopic expression in T-cell leukaemia.
More...