Property Summary

NCBI Gene PubMed Count 106
Grant Count 75
R01 Count 35
Funding $7,303,950.3
PubMed Score 195.09
PubTator Score 161.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P25791 Q9HD58
Symbols TTG2
RBTN2
RHOM2
RBTNL1

Gene

PDB

2XJY   2XJZ   2YPA   4KFZ  

Gene RIF (66)

PMID Text
26598604 Alanine scanning mutagenesis of the LIM interaction domain of LDB1 revealed a discrete motif, R(320)LITR, required for LMO2 binding.
26161748 Data show that the Lim domain only 2 (LMO2) regulatory element (element-25) region consists of transcription factor GATA2-binding myeloid ennhancer and RUNX protein-binding T-cell repressor.
25721045 LMO2 expression was elevated in GBM tissues and inversely correlated with prognosis of GBM patients. Taken together, our findings describe novel dual roles of LMO2 to induce tumorigenesis and angiogenesis.
25710580 that suppression of MIR223 expression, as compared with controls, is associated with lack of differentiation and adverse cytogenetic profile, but unrelated with LMO2 protein expression or overall survival.
25682596 Cryptic chromosomal rearrangements in the LMO2 gene were associated with T-cell acute lymphoblastic leukemia.
25499232 results suggest that E47 has diverse effects in T-ALL but that functional deficiency of E47 is not a universal feature of Lmo2-induced T-ALL.
25203428 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
24465765 HHEX is a direct transcriptional target of LMO2 consistent with its concordant gene expression.
24330148 LMO2 is expressed in a subset of acute myeloid leukaemia patients and is associated with normal karyotype, which is different from T lymphoblastic lymphoma/leukaemia, where specific translocation (11p13) mediates protein expression.
23897248 Staining for LMO2 in addition to CD10 and BCL6 facilitates the detection of a germinal center phenotype in follicular lymphoma
More...

AA Sequence

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR      1 - 70
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS     71 - 140
DIVCEQDIYEWTKINGMI                                                        141 - 158
//

Text Mined References (106)

PMID Year Title
26598604 2015 LMO2 Oncoprotein Stability in T-Cell Leukemia Requires Direct LDB1 Binding.
26161748 2015 The LMO2 -25 Region Harbours GATA2-Dependent Myeloid Enhancer and RUNX-Dependent T-Lymphoid Repressor Activity.
25721045 2015 The LIM-only transcription factor LMO2 determines tumorigenic and angiogenic traits in glioma stem cells.
25710580 De Novo Acute Myeloid Leukemia in Adults: Suppression of MicroRNA-223 is Independent of LMO2 Protein Expression BUT Associate With Adverse Cytogenetic Profile and Undifferentiated Blast Morphology.
25682596 2015 High frequency of cryptic chromosomal rearrangements involving the LMO2 gene in T-cell acute lymphoblastic leukemia.
25499232 2015 Enforced expression of E47 has differential effects on Lmo2-induced T-cell leukemias.
25416956 2014 A proteome-scale map of the human interactome network.
25203428 2015 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
24465765 2014 LIM domain only-2 (LMO2) induces T-cell leukemia by two distinct pathways.
24379077 2014 LIM-domain-only proteins: multifunctional nuclear transcription coregulators that interacts with diverse proteins.
More...