Property Summary

NCBI Gene PubMed Count 117
PubMed Score 199.03
PubTator Score 161.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 3.7e-07
Breast cancer -1.200 9.8e-07
breast carcinoma -1.100 1.0e-05
Chronic Lymphocytic Leukemia -1.657 6.7e-06
chronic rhinosinusitis -1.461 9.8e-03
glioblastoma 2.000 4.3e-03
group 3 medulloblastoma 1.400 1.3e-02
intraductal papillary-mucinous adenoma (... -1.600 4.4e-03
intraductal papillary-mucinous carcinoma... -1.900 2.4e-03
invasive ductal carcinoma -1.500 1.6e-03
lung adenocarcinoma -2.000 4.2e-12
nasopharyngeal carcinoma -1.600 1.8e-05
non-small cell lung cancer -1.853 4.5e-23
osteosarcoma -2.208 8.9e-05
ovarian cancer -2.000 2.3e-06
primary Sjogren syndrome 1.200 1.1e-02
subependymal giant cell astrocytoma 1.872 3.9e-02
tuberculosis 1.700 5.1e-06
ulcerative colitis 1.600 1.5e-04
Waldenstrons macroglobulinemia -1.174 7.7e-03

Gene RIF (77)

AA Sequence

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR      1 - 70
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS     71 - 140
DIVCEQDIYEWTKINGMI                                                        141 - 158
//

Text Mined References (117)

PMID Year Title