Property Summary

NCBI Gene PubMed Count 81
PubMed Score 15.83
PubTator Score 15.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.100 1.4e-02
Multiple myeloma 1.276 1.0e-02
osteosarcoma -1.928 1.8e-05
ovarian cancer -1.500 1.0e-03
pancreatic ductal adenocarcinoma liver m... -1.618 2.9e-02
primary Sjogren syndrome 1.500 2.1e-02
psoriasis 1.200 1.3e-14
Waldenstrons macroglobulinemia 1.441 1.6e-02

Gene RIF (35)

AA Sequence

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV      1 - 70
DRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGS     71 - 140
YSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAF    141 - 210
ELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM                             211 - 255
//

Text Mined References (110)

PMID Year Title