Property Summary

NCBI Gene PubMed Count 77
PubMed Score 27.84
PubTator Score 15.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.441 0.016
Multiple myeloma 1.276 0.010
osteosarcoma -1.928 0.000
pancreatic ductal adenocarcinoma liver m... -1.618 0.029
primary Sjogren syndrome 1.500 0.021
psoriasis 1.200 0.000
ovarian cancer 2.300 0.000
dermatomyositis 1.100 0.014

Synonym

Accession P25788 B2RCK6 Q86U83 Q8N1D8 Q9BS70
Symbols HC8
PSC3

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7   5DSV  

Gene RIF (37)

PMID Text
26661414 Our results provide evidence on new T1DM-susceptible loci in the PSMA3, PSMA6 and PSMC6 proteasome genes and give a new insight into the T1DM pathogenesis
26070558 Protein interaction between Ambn and Psma3 can facilitate redistribution of ameloblastin domains within forming enamel.
24875235 Evidence of a sex-specific association of PSMA3 genetic variants with subtypes of juvenile idiopathic arthritis.
22079093 A combination of two-dimensional gel electrophoresis (2D-GE) and tandem mass-spectrometry revealed a large number of PSMA3-bound proteins that are involved in various aspects of mRNA metabolism, including splicing.
21135093 Plasminogen activator inhibitor type 1 interacts with alpha3 subunit of proteasome and modulates its activity.
21108816 Serum 20S proteasome concentration and percentage of lymphocytic apoptosis predicted survival and patient prognosis in critically ill patients.
18971267 The authors propose that the full-length HCV F protein as well as the F protein initiating from codon 26 is degraded by an ubiquitin-independent pathway that is mediated by the proteasome subunit alpha3.
18854154 Knockdown of proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15831937 EBNA3C binds to human the C8/alpha7 subunit of the 20S proteasome; degraded by purified 20S proteasomes in vitro but, found to be very stable and apparently turned over at a very low rate in B cells infected latently with EBV
14674694 Aurora-B might undergo degradation by binding to HC8 in a proteasome-dependent manner during mitosis
More...

AA Sequence

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV      1 - 70
DRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGS     71 - 140
YSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAF    141 - 210
ELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM                             211 - 255
//

Text Mined References (96)

PMID Year Title
26661414 2016 Genetic variations in the PSMA3, PSMA6 and PSMC6 genes are associated with type 1 diabetes in Latvians and with expression level of number of UPS-related and T1DM-susceptible genes in HapMap individuals.
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
26070558 2015 Protein Interaction between Ameloblastin and Proteasome Subunit ? Type 3 Can Facilitate Redistribution of Ameloblastin Domains within Forming Enamel.
25416956 2014 A proteome-scale map of the human interactome network.
24875235 2014 Juvenile idiopathic arthritis subtype- and sex-specific associations with genetic variants in the PSMA6/PSMC6/PSMA3 gene cluster.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22659184 2012 Mutational analysis reveals a dual role of Mdm2 acidic domain in the regulation of p53 stability.
More...