Property Summary

NCBI Gene PubMed Count 62
PubMed Score 5.78
PubTator Score 13.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Heart Diseases 43 0.0 0.0
Osteoporosis 363 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.8e-07
malignant mesothelioma 3232 3.4e-06
psoriasis 6694 4.5e-05
Breast cancer 3578 2.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.800 2.4e-02
malignant mesothelioma 1.300 3.4e-06
ovarian cancer -1.500 2.8e-07
psoriasis 2.000 4.5e-05

Gene RIF (26)

AA Sequence

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITK      1 - 70
HIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWN     71 - 140
EGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEV    141 - 210
GICNEAGFRRLTPTEVKDYLAAIA                                                  211 - 234
//

Text Mined References (80)

PMID Year Title