Property Summary

Ligand Count 1
NCBI Gene PubMed Count 47
PubMed Score 17.38
PubTator Score 15.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (28)

AA Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHI      1 - 70
GISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDM     71 - 140
GPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNV    141 - 210
SIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH                     211 - 263
//

Text Mined References (63)

PMID Year Title