Property Summary

NCBI Gene PubMed Count 130
Grant Count 415
R01 Count 252
Funding $61,937,066.65
PubMed Score 1859.47
PubTator Score 198.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P25774 B4DWC9 D3DV05 Q5T5I0 Q6FHS5 Q9BUG3
Symbols

Gene

PANTHER Protein Class (3)

PDB

1BXF   1GLO   1MS6   1NPZ   1NQC   2C0Y   2F1G   2FQ9   2FRA   2FRQ   2FT2   2FUD   2FYE   2G6D   2G7Y   2H7J   2HH5   2HHN   2HXZ   2OP3   2R9M   2R9N   2R9O   3IEJ   3KWN   3MPE   3MPF   3N3G   3N4C   3OVX   4P6E   4P6G  

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
501 screening 33 / 268 / 61728 Cathepsin S
831 confirmatory 34 / 0 / 95 Cathepsin S dose-response confirmation

Gene RIF (95)

PMID Text
26960148 p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells.
26081835 shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity.
26079659 levels of cathepsin S and hsCRP observed in women who later developed breast cancer may provide prognostic information regarding tumor development and need to be evaluated in prospective studies.
26029922 the essential role of autophagy-regulated early ROS in triggering late apoptotic signaling
25626674 The study determined almost identical substrate specificities for cysteine cathepsins K, L and S.
25118282 results identify Cat-S as a biased agonist of PAR2 that causes PAR2- and TRPV4-dependent inflammation and pain.
25086747 High cathepsin S expression at the primary site correlates with decreased brain metastasis-free survival in breast cancer patients.
24964046 Cathepsin S cleaves near the N-terminus of PAR2 to expose a novel tethered ligand, KVDGTS.
24940638 The miR-31/IRF-1/CTSS pathway may play a functional role in the pathogenesis of cystic fibrosis lung disease.
24875536 Cathepsin S plays an important role in the regulation of autophagy and apoptosis in human glioblastoma cells.
More...

AA Sequence

MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGM      1 - 70
HSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACW     71 - 140
AFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMD    141 - 210
QKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGV    211 - 280
LVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI                       281 - 331
//

Text Mined References (135)

PMID Year Title
26960148 2016 Exogenous Thyropin from p41 Invariant Chain Diminishes Cysteine Protease Activity and Affects IL-12 Secretion during Maturation of Human Dendritic Cells.
26081835 2015 Proteomic Identification of Cysteine Cathepsin Substrates Shed from the Surface of Cancer Cells.
26079659 2015 Is There Any Role for Serum Cathepsin S and CRP Levels on Prognostic Information in Breast Cancer? The Swedish Mammography Cohort.
26029922 2015 Autophagy-Regulated ROS from Xanthine Oxidase Acts as an Early Effector for Triggering Late Mitochondria-Dependent Apoptosis in Cathepsin S-Targeted Tumor Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25626674 2015 Fast profiling of protease specificity reveals similar substrate specificities for cathepsins K, L and S.
25118282 2014 Cathepsin S causes inflammatory pain via biased agonism of PAR2 and TRPV4.
25086747 2014 Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S.
24964046 2014 Cathepsin S signals via PAR2 and generates a novel tethered ligand receptor agonist.
24940638 2014 miR-31 dysregulation in cystic fibrosis airways contributes to increased pulmonary cathepsin S production.
More...