Property Summary

NCBI Gene PubMed Count 65
PubMed Score 191.77
PubTator Score 308.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 5.90405001441477E-19
diabetes mellitus 1663 0.00110107034418028
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.755 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 0.001
psoriasis -1.700 0.000

Synonym

Accession P25713 Q2V574 MT-3
Symbols GIF
GIFB
GRIF
ZnMT3

Gene

MT3

PDB

2F5H   2FJ4   2FJ5  

Gene RIF (40)

PMID Text
25933064 MT3 may regulate breast cancer cell invasiveness by modulating the expression of MMP3.
25803827 The study implicates the unique C-terminal sequence of MT-3 in the conversion of HK-2 cells to display an enhanced epithelial phenotype.
24859040 MT-capital I, Ukrainiancapital I, Ukrainiancapital I, Ukrainian increases the amount of active ADAM10 in association with furin, PC7 and PKCalpha.
24242700 The presence of MT-3 in the zona glomerulosa of pathological adrenal cortex may imply a role in the pathophysiology of aldosterone-producing tissues.
24222235 Upregulation of MT-3 gene expression can inhibit esophageal cancer cell proliferation and induce apoptosis.
23794209 The experiments indicate that MT3 is an androgen-upregulated gene, and promotes tumorigenesis of prostate carcinoma cells.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
23482768 MT-III expression may have an impact on the pathogenesis of non-small cell lung cancer.
23086305 the molecular mechanism for protection against the neuronal cytotoxicity of Abeta(1-42) with copper ions
22615124 MT-3 modulates the catalytic redox properties of PrP-Cu(II)
More...

AA Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ        1 - 68
//

Text Mined References (65)

PMID Year Title
25933064 2015 Metallothionein-3 Increases Triple-Negative Breast Cancer Cell Invasiveness via Induction of Metalloproteinase Expression.
25803827 2015 Cadherin expression, vectorial active transport, and metallothionein isoform 3 mediated EMT/MET responses in cultured primary and immortalized human proximal tubule cells.
24859040 2014 Metallothionein-III increases ADAM10 activity in association with furin, PC7, and PKC? during non-amyloidogenic processing.
24242700 2014 Metallothionein-3 (MT-3) in the human adrenal cortex and its disorders.
24222235 2013 Effects of metallothionein-3 and metallothionein-1E gene transfection on proliferation, cell cycle, and apoptosis of esophageal cancer cells.
23794209 2013 Metallothionein 3: an androgen-upregulated gene enhances cell invasion and tumorigenesis of prostate carcinoma cells.
23482768 2013 Expression of metallothionein-III in patients with non-small cell lung cancer.
23086305 2013 The molecular mechanism for human metallothionein-3 to protect against the neuronal cytotoxicity of A?(1-42) with Cu ions.
22615124 2012 The catalytic redox activity of prion protein-Cu(II) is controlled by metal exchange with the Zn(II) -thiolate clusters of Zn(7) metallothionein-3.
21818286 2011 Location-specific epigenetic regulation of the metallothionein 3 gene in esophageal adenocarcinomas.
More...