Property Summary

NCBI Gene PubMed Count 70
PubMed Score 197.68
PubTator Score 308.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 1.1e-03
psoriasis -1.700 5.9e-19

Gene RIF (43)

AA Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ        1 - 68
//

Text Mined References (70)

PMID Year Title