Property Summary

NCBI Gene PubMed Count 65
Grant Count 25
R01 Count 11
Funding $2,567,800.4
PubMed Score 191.77
PubTator Score 308.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 0.001
psoriasis -1.700 0.000

Gene RIF (40)

PMID Text
25933064 MT3 may regulate breast cancer cell invasiveness by modulating the expression of MMP3.
25803827 The study implicates the unique C-terminal sequence of MT-3 in the conversion of HK-2 cells to display an enhanced epithelial phenotype.
24859040 MT-capital I, Ukrainiancapital I, Ukrainiancapital I, Ukrainian increases the amount of active ADAM10 in association with furin, PC7 and PKCalpha.
24242700 The presence of MT-3 in the zona glomerulosa of pathological adrenal cortex may imply a role in the pathophysiology of aldosterone-producing tissues.
24222235 Upregulation of MT-3 gene expression can inhibit esophageal cancer cell proliferation and induce apoptosis.
23794209 The experiments indicate that MT3 is an androgen-upregulated gene, and promotes tumorigenesis of prostate carcinoma cells.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
23482768 MT-III expression may have an impact on the pathogenesis of non-small cell lung cancer.
23086305 the molecular mechanism for protection against the neuronal cytotoxicity of Abeta(1-42) with copper ions
22615124 MT-3 modulates the catalytic redox properties of PrP-Cu(II)
More...

AA Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ        1 - 68
//

Text Mined References (65)

PMID Year Title
25933064 2015 Metallothionein-3 Increases Triple-Negative Breast Cancer Cell Invasiveness via Induction of Metalloproteinase Expression.
25803827 2015 Cadherin expression, vectorial active transport, and metallothionein isoform 3 mediated EMT/MET responses in cultured primary and immortalized human proximal tubule cells.
24859040 2014 Metallothionein-III increases ADAM10 activity in association with furin, PC7, and PKC? during non-amyloidogenic processing.
24242700 2014 Metallothionein-3 (MT-3) in the human adrenal cortex and its disorders.
24222235 2013 Effects of metallothionein-3 and metallothionein-1E gene transfection on proliferation, cell cycle, and apoptosis of esophageal cancer cells.
23794209 2013 Metallothionein 3: an androgen-upregulated gene enhances cell invasion and tumorigenesis of prostate carcinoma cells.
23482768 2013 Expression of metallothionein-III in patients with non-small cell lung cancer.
23086305 2013 The molecular mechanism for human metallothionein-3 to protect against the neuronal cytotoxicity of A?(1-42) with Cu ions.
22615124 2012 The catalytic redox activity of prion protein-Cu(II) is controlled by metal exchange with the Zn(II) -thiolate clusters of Zn(7) metallothionein-3.
21818286 2011 Location-specific epigenetic regulation of the metallothionein 3 gene in esophageal adenocarcinomas.
More...