Property Summary

NCBI Gene PubMed Count 63
Grant Count 57
R01 Count 17
Funding $13,644,220.23
PubMed Score 115.09
PubTator Score 53.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.654 0.029
lung cancer 1.500 0.001
ovarian cancer -1.600 0.000

Synonym

Accession P25705 A8K092 B4DY56 K7ENP3 Q53XX6 Q8IXV2 Q96FB4 Q96HW2 Q96IR6 Q9BTV8
Symbols OMR
ORM
ATPM
MOM2
ATP5A
hATP1
MC5DN4
ATP5AL2
COXPD22
HEL-S-123m

Gene

 IMPC Term (1)

Gene RIF (32)

PMID Text
26769832 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase
26526033 High mRNA levels of ATP5A1 are associated with glioblastoma.
26358770 Here, we found that ATP synthase subunit alpha (ATP5A) was O-GlcNAcylated at Thr432 and ATP5A O-GlcNAcylation was decreased in the brains of AD patients and transgenic mouse model
26246018 Mitochondrial calpain-1 disrupts ATP synthase, leading to mitochondrial reactive oxygen species generation, which promotes proinflammatory response and myocardial dysfunction during endotoxemia.
25999424 Studies indicate that the F-ATP synthase can reversibly undergo a Ca(2+)-dependent transition to form a channel that mediates the permeability transition.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase F1 complex, alpha subunit 1 (ATP5A1) expression by HIV-1 Vpr in Vpr transduced macrophages
23599390 A mutation in ATP5A1 causes a fatal neonatal mitochondrial encephalopathy.
23596069 Homozygous mutations in this gene are the likely cause of mitochondrial disease in two sisters, with support from a yeast model.
23395605 Studies indicate that F1-ATPase (F1) is a rotary motor protein driven by ATP hydrolysis and the minimum complex of F1 for function as a rotary motor is the alpha3beta3gamma subcomplex.
23364796 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase F1 complex, alpha subunit 1 (ATP5A1) expression by HIV-1 Vpr in Vpr transduced macrophages
More...

AA Sequence

MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEE      1 - 70
TGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDV     71 - 140
PVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELI    141 - 210
IGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS    211 - 280
DAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE    281 - 350
RAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA    351 - 420
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYA    421 - 490
GVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA           491 - 553
//

Text Mined References (71)

PMID Year Title
26769832 2015 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase.
26526033 2016 ATP5A1 and ATP5B are highly expressed in glioblastoma tumor cells and endothelial cells of microvascular proliferation.
26358770 2015 Mitochondrial ATP synthase activity is impaired by suppressed O-GlcNAcylation in Alzheimer's disease.
26246018 2015 Deletion of capn4 Protects the Heart Against Endotoxemic Injury by Preventing ATP Synthase Disruption and Inhibiting Mitochondrial Superoxide Generation.
25999424 2015 From ATP to PTP and Back: A Dual Function for the Mitochondrial ATP Synthase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23599390 2013 A complex V ATP5A1 defect causes fatal neonatal mitochondrial encephalopathy.
23596069 2013 Targeted exome sequencing of suspected mitochondrial disorders.
More...