Property Summary

NCBI Gene PubMed Count 79
PubMed Score 394.20
PubTator Score 95.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.300 3.2e-02
chronic rhinosinusitis -1.021 4.0e-02
esophageal adenocarcinoma -1.500 1.9e-02
glioblastoma 2.500 1.5e-02
group 4 medulloblastoma -1.100 4.7e-03
intraductal papillary-mucinous adenoma (... 1.100 1.0e-02
Multiple myeloma 1.126 2.0e-02
pancreatic cancer 1.200 6.2e-04
primary pancreatic ductal adenocarcinoma 1.397 2.6e-02
psoriasis 1.200 1.7e-06
spina bifida -1.277 4.1e-02
tuberculosis -1.300 8.8e-03
Waldenstrons macroglobulinemia 1.176 4.3e-02

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (47)

AA Sequence

MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE      1 - 70
GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG     71 - 140
FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK    141 - 210
GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT    211 - 280
IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI              281 - 340
//

Text Mined References (84)

PMID Year Title