Property Summary

NCBI Gene PubMed Count 75
Grant Count 221
R01 Count 147
Funding $18,556,013.02
PubMed Score 367.94
PubTator Score 95.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.176 0.043
Multiple myeloma 1.230 0.004
esophageal adenocarcinoma -1.500 0.019
psoriasis 1.200 0.000
glioblastoma 2.500 0.015
astrocytoma 1.300 0.032
tuberculosis -1.300 0.009
primary pancreatic ductal adenocarcinoma 1.397 0.026
intraductal papillary-mucinous adenoma (... 1.100 0.010
pancreatic cancer 1.500 0.017
group 4 medulloblastoma -1.100 0.005
spina bifida -1.277 0.041
chronic rhinosinusitis -1.021 0.040

Synonym

Accession P25685 B4DX52
Symbols Hdj1
Sis1
HSPF1
Hsp40
RSPH16B

Gene

PANTHER Protein Class (2)

PDB

4WB7   1HDJ   2QLD   3AGX   3AGY   3AGZ  

Gene RIF (47)

PMID Text
26505878 DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target
26336106 siRNA experiments confirmed that a reduction in Hsp27 or Hsp40 rescued CFTR in the DeltaF508 mutant, but the rescue was not additive or synergistic with C4 + 18 treatment, indicating these correctors shared a common pathway for rescue
26239118 study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator.
25557953 In this cohort of fibrolamellar hepatocellular carcinoma, almost 80% contained the DNAJB1-PRKACA fusion transcript.
25472883 HIV-1 Tat specifically associates with DNAJB1 promoter to upregulate DNAJB1 expression in T cells
25444898 Authors identified DNAJB1 as a negative regulator of PDCD5-mediated apoptosis and found that the apoptosis network of PDCD5 regulates cancer cell death.
25122662 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3.
25058638 We also found that, despite an initial report to the contrary, the human homolog of Sis1, Hdj1, is capable of [PSI+] prion propagation in place of Sis1
24658033 HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells.
24578576 Evidence supporting the presence of the DNAJB1-PRKACA chimeric transcript in 100% of the FL-HCCs examined (15/15) suggests that this genetic alteration contributes to tumor pathogenesis.
More...

AA Sequence

MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE      1 - 70
GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG     71 - 140
FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK    141 - 210
GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT    211 - 280
IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI              281 - 340
//

Text Mined References (81)

PMID Year Title
27120771 2016 Polyhydramnios, Transient Antenatal Bartter's Syndrome, and MAGED2 Mutations.
26505878 2016 The DNAJB1-PRKACA chimera: Candidate biomarker and therapeutic target for fibrolamellar carcinomas.
26336106 2015 Combination of Correctors Rescue ?F508-CFTR by Reducing Its Association with Hsp40 and Hsp27.
26239118 2015 DNAJB1 negatively regulates MIG6 to promote epidermal growth factor receptor signaling.
25557953 2015 Unique genomic profile of fibrolamellar hepatocellular carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25444898 2015 DNAJB1 destabilizes PDCD5 to suppress p53-mediated apoptosis.
25122662 2015 Genomic analysis of fibrolamellar hepatocellular carcinoma.
25058638 2014 Functional diversification of hsp40: distinct j-protein functional requirements for two prions allow for chaperone-dependent prion selection.
24658033 2014 HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells.
More...