Property Summary

NCBI Gene PubMed Count 218
Grant Count 254
R01 Count 206
Funding $25,563,522.43
PubMed Score 593.97
PubTator Score 453.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P25490 Q14935
Symbols DELTA
NF-E1
UCRBP
INO80S
YIN-YANG-1

Gene

YY1

PDB

4C5I   1UBD   1ZNM  

Gene RIF (186)

PMID Text
26910132 Significance of the pathogenic mutation T372R in the Yin Yang 1 protein interaction with DNA--thermodynamic studies: the mutation does not affect the secondary structure of either zinc fingers or the N-terminal fragment of the protein.
26800240 YY1 overexpression contributes to EZH2 recruitment for H3K27me3-mediated silencing of tumour-suppressive microRNAs, thereby activating NF-kappaB signalling in hepatocarcinogenesis.
26786659 YY1 regulates lung CCL4 transcription in pulmonary tuberculosis.
26618242 Study shows that YY1 regulates inflammatory responses in vascular endothelium through its binding to ANRIL.
26329601 These data demonstrate the crucial requirement for YY1 in lung morphogenesis.
26292095 IL-18 induced YY1 expression, which repressed FXR and MRP2 expression in HepG2 cells.
26198631 Data show that YY1 transcription factor (YY1) is tyrosine-phosphorylated by Src family kinases, leading to down-regulation of its activity.
26104682 Results identify a novel YY1 ~ miR-9 ~ RYBP axis involved in melanoma tumorigenesis and reinforce the idea that regulatory circuitries involving miRNAs and TFs are prevalent mechanisms.
25963536 The results of our study indicate that YY1 belongs to the family of intrinsically disordered proteins, which exist natively in a partially unfolded conformation.
25954903 Rescue experiments indicated that the suppressive effect of miR-34a on invasion and migration was mediated by activating YY1 expression.
More...

AA Sequence

MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGH      1 - 70
HHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAG     71 - 140
GDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQV    141 - 210
QIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFA    211 - 280
RMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE    281 - 350
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ          351 - 414
//

Text Mined References (234)

PMID Year Title
26910132 2016 Significance of the pathogenic mutation T372R in the Yin Yang 1 protein interaction with DNA--thermodynamic studies.
26800240 2016 Yin Yang 1-mediated epigenetic silencing of tumour-suppressive microRNAs activates nuclear factor-?B in hepatocellular carcinoma.
26786659 2016 A novel role of Yin-Yang-1 in pulmonary tuberculosis through the regulation of the chemokine CCL4.
26618242 2016 Long non-coding RNA ANRIL regulates inflammatory responses as a novel component of NF-?B pathway.
26329601 2015 Epithelial inactivation of Yy1 abrogates lung branching morphogenesis.
26292095 2015 Interleukin-18 Down-Regulates Multidrug Resistance-Associated Protein 2 Expression through Farnesoid X Receptor Associated with Nuclear Factor Kappa B and Yin Yang 1 in Human Hepatoma HepG2 Cells.
26198631 2015 Regulation of Yin Yang 1 by Tyrosine Phosphorylation.
26104682 2015 YY1 regulates melanoma tumorigenesis through a miR-9?~?RYBP axis.
25963536 2015 Intrinsic disorder of human Yin Yang 1 protein.
25954903 2015 miR-34a inhibits the migration and invasion of esophageal squamous cell carcinoma by targeting Yin Yang-1.
More...