Property Summary

NCBI Gene PubMed Count 1,059
PubMed Score 2090.17
PubTator Score 1849.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Abdominal Pain 98
Abnormal blistering of the skin 54
Abnormal eyelashes 13
Acne 52
Angle class 2 malocclusion 57
Angle class 3 malocclusion 57
Anti-nuclear factor positive 18
Antiphospholipid antibody positivity 4
Aphthous stomatitis 16
Apraxias 27
Arthralgia 90
Arthritis 290
Autoimmune hemolytic anemia 31
Autoimmune neutropenia 5
Autoimmune thrombocytopenia 22
Behcet Syndrome 21
Bladder Neoplasm 112
Blister of skin 54
C-reactive protein increased 15
Cataract 297
Chronic noninfectious lymphadenopathy 6
Confusion 21
Coombs positive hemolytic anemia 4
Decreased joint mobility 53
Defective lymphocyte apoptosis 4
Diabetes Mellitus, Non-Insulin-Dependent 145
Diffuse large B-cell lymphoma 39
ESR raised 20
Elevated C-reactive protein level 15
Elevated serum IgA 5
Eosinophilia 28
Eyebrow abnormalities 12
Fatigue 182
Fever 138
Follicular hyperplasia 4
Gait abnormality 135
Gastrointestinal Hemorrhage 52
Glaucoma 239
Hematological Disease 18
Hemiparesis 34
Hepatomegaly 285
Idiopathic thrombocytopenia 22
Immune thrombocytopenic purpura 24
Immunologic Hypersensitivity 10
Impaired cognition 96
Increased IgM levels 16
Increased levels of IgG 4
Increased number of CD4-/CD8- T cells expressing alpha/beta T-cell receptors 3
Increased number of peripheral CD3+ T cells 3
Increased proportion of HLA DR+ and CD57+ T cells 3
Intermittent migraine headaches 68
Iridocyclitis 19
Iron deficiency anemia 12
Joint swelling 26
Juvenile rheumatoid arthritis 111
Lens Opacities 231
Leukemia, Myelocytic, Acute 120
Low Vision 174
Malocclusion 57
Meningitis 67
Mental impairment 95
Migraine Disorders 76
Multiple, subcutaneous nodules 53
Myalgia 54
Nausea and vomiting 97
Neutrophil antibody positive 3
Oral Ulcer 15
Orchitis 28
Papule 43
Pauciarticular juvenile rheumatoid arthritis 9
Photodysphoria 121
Photophobia 121
Platelet antibody positive 4
Poliosis 2
Polyarthritis 11
Premature canities 24
Recurrent aphthous ulcer 14
Reduced delayed hypersensitivity 4
Retinal Detachment 51
Rheumatoid factor positive (finding) 3
Schizophrenia 1160
Sensorineural Hearing Loss (disorder) 284
Short stature 531
Skin bulla 54
Smooth muscle antibodies positive 3
Sparse scalp hair 42
Splenomegaly 190
Subcutaneous nodule 53
Urticaria 67
Uveomeningoencephalitic Syndrome 3
Vasculitis 80
Venous Thrombosis 47
Visual Impairment 174
Vitiligo 73
hypopigmented skin patch 59

Expression

  Differential Expression (25)

Disease log2 FC p
Astrocytoma, Pilocytic 2.100 1.1e-06
atypical teratoid / rhabdoid tumor 1.800 1.5e-02
Breast cancer -1.500 2.8e-06
colon cancer -1.800 3.8e-04
ependymoma 2.700 2.8e-09
gastric carcinoma 1.500 3.1e-02
Gaucher disease type 3 -1.300 2.3e-03
glioblastoma 1.500 5.2e-04
group 4 medulloblastoma -1.100 1.8e-02
Hydrolethalus syndrome 1.065 3.9e-02
interstitial cystitis 1.200 2.8e-03
lung cancer -2.500 3.0e-04
lung carcinoma -1.700 5.2e-20
malignant mesothelioma -4.500 1.1e-09
medulloblastoma, large-cell -1.200 1.4e-02
nasopharyngeal carcinoma 1.200 3.3e-03
non-small cell lung cancer -1.018 4.0e-09
ovarian cancer -2.400 3.3e-05
pancreatic cancer 1.200 1.4e-03
pediatric high grade glioma 1.600 8.6e-04
pituitary cancer -1.300 2.1e-04
primary pancreatic ductal adenocarcinoma 1.276 9.1e-04
primary Sjogren syndrome 1.700 5.1e-04
psoriasis -1.800 1.0e-03
subependymal giant cell astrocytoma 1.995 1.6e-02

Gene RIF (1057)

AA Sequence

MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKA      1 - 70
RDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVC     71 - 140
EHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSH    141 - 210
ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRN    211 - 280
WHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV                   281 - 335
//

Text Mined References (1068)

PMID Year Title