Property Summary

NCBI Gene PubMed Count 1,020
Grant Count 420
R01 Count 262
Funding $34,031,990.22
PubMed Score 2052.72
PubTator Score 1849.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (59)

Disease Z-score Confidence
Autoimmune Lymphoproliferative Syndrome 12 5.989 3.0
Cancer 2,346 5.528 2.8
Human immunodeficiency virus infectious ... 92  4.414 2.2
Hypersensitivity reaction type II diseas... 235  4.346 2.2
Lymphopenia 35 3.892 1.9
Liver disease 219 3.833 1.9
Lattice corneal dystrophy 4 3.831 1.9
Multiple Sclerosis 498 3.457 1.7
Primary immunodeficiency disease 52 3.071 1.5
Acute Lung Injury 18
Autoimmune Diseases 33
Autoimmune Lymphoproliferative Syndrome,... 1 
Bladder Neoplasm 109
Breast cancer 3,094
Cardiomyopathies 90
Cardiomyopathy, Dilated 47
Chronic Lymphocytic Leukemia 242
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diffuse large B-cell lymphoma 41
Gaucher disease type 3 76
Heart conduction disease 65 1.0
Hematological Disease 8
Hydrolethalus syndrome 128
Hypersplenism 9
Leukemia, Myelocytic, Acute 113
Liver Failure, Acute 22
Lung Neoplasms 171
Lymphoma, T-Cell, Cutaneous 21
Malaria, Falciparum 3
Motor neuron disease 39 1.0
Myasthenia Gravis 26
Necrosis 51
Non-alcoholic Fatty Liver Disease 40
Pregnancy Complications, Cardiovascular 4
Taste Disorders 2
Ventricular Dysfunction, Left 15
atypical teratoid/rhabdoid tumor 1,095
colon cancer 1,475
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (25)

Synonym

Accession P25445 A9UJX4 B6VNV4 Q14292 Q14293 Q14294 Q14295 Q16652 Q5T9P1 Q5T9P2 Q5T9P3 Q6SSE9
Symbols APT1
CD95
FAS1
APO-1
FASTM
ALPS1A
TNFRSF6

Gene

FAS

PDB

1BZI   1DDF   2NA7   3EWT   3EZQ   3THM   3TJE  

Gene RIF (1037)

PMID Text
27141571 Renal CD95 expression is decreased in diabetes.
27050822 Meta-analysis: FAS -670 A/G, and FAS -1377 G/A polymorphisms are associated with susceptibility to systemic lupus erythematosus.
26942442 Dephosphorylation of Fas tyrosines by SHP-1 tyrosine phosphatase turns on the pro-apoptotic signal whereas the tyrosine phosphorylation by Src family kinases turns off the pro-apoptotic signal and turns on the pro-survival signal.
26911253 K8/18 filaments provide resistance to apoptosis in granulosa cell tumor cells by impairing FAS expression.
26858129 These results suggested that FAS/FASL polymorphisms might significantly modify SPM risk among patients with SCCHN in a tumor site-specific manner.
26853147 Data determined the transmembrane domain structure of Fas and showed that the trimer assembly, which is mediated by a proline-containing motif, is essential for Fas signaling providing structural explanation for many known cancer mutations in this domain.
26823709 Suggest reduced membranous Fas expression as a mechanism of apoptotic resistance in non-small cell lung carcinomas.
26690594 Frequencies of SNPs rs2234978 and rs1045487 of FAS and CASP8 genes were significantly higher in Autoimmune Lymphoproliferative Syndrome patients.
26617948 Abnormal Fas/FasL expression in gastric cardia carcinoma and lymph node tissues are involved in carcinogenesis and metastasis of gastric cancer.
26617708 Fas/FasL system and downstream activation of caspases are important mediators of apoptosis and may be involved in the pathogenesis of pulmonary edema in severe P. falciparum malaria patients.
More...

AA Sequence

MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKA      1 - 70
RDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVC     71 - 140
EHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSH    141 - 210
ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRN    211 - 280
WHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV                   281 - 335
//

Text Mined References (1029)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27050822 Associations between the FAS -670 A/G, -1377 G/A, and FASL -844 T/C polymorphisms and susceptibility to systemic lupus erythematosus: a meta-analysis.
26942442 2016 An Evolution-Guided Analysis Reveals a Multi-Signaling Regulation of Fas by Tyrosine Phosphorylation and its Implication in Human Cancers.
26911253 2016 Molecular manipulation of keratin 8/18 intermediate filaments: modulators of FAS-mediated death signaling in human ovarian granulosa tumor cells.
26858129 2016 Site disparities in apoptotic variants as predictors of risk for second primary malignancy in patients with squamous cell carcinoma of the head and neck.
26853147 2016 Structural Basis and Functional Role of Intramembrane Trimerization of the Fas/CD95 Death Receptor.
26823709 2015 Relationship of Fas, FasL, p53 and bcl-2 expression in human non-small cell lung carcinomas.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26617948 2015 Significance of Fas and FasL protein expression in cardiac carcinoma and local lymph node tissues.
26617708 2015 Enhanced expression of Fas and FasL modulates apoptosis in the lungs of severe P. falciparum malaria patients with pulmonary edema.
More...