Property Summary

NCBI Gene PubMed Count 58
Grant Count 65
R01 Count 26
Funding $10,932,422.64
PubMed Score 0.00
PubTator Score 345.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.005
osteosarcoma 1.447 0.001
astrocytoma 1.600 0.008
juvenile dermatomyositis 1.438 0.000
acute quadriplegic myopathy 1.029 0.001
pancreatic ductal adenocarcinoma liver m... 2.177 0.004
primary Sjogren syndrome -1.100 0.011
acute myeloid leukemia 1.100 0.004
ovarian cancer 2.400 0.000
dermatomyositis -1.200 0.000

Synonym

Accession P25440 A2AAU0 B0S7P0 B1AZT1 O00699 O00700 Q15310 Q5STC9 Q63HQ9 Q658Y7 Q6P3U2 Q969U4
Symbols FSH
NAT
RNF3
FSRG1
RING3
D6S113E
O27.1.1

Gene

PDB

1X0J   2DVQ   2DVR   2DVS   2DVV   2E3K   2G4A   2YDW   2YEK   3AQA   3ONI   4A9E   4A9F   4A9H   4A9I   4A9J   4A9M   4A9N   4A9O   4AKN   4ALG   4ALH   4J1P   4MR5   4MR6   4QEU   4QEV   4QEW   4UYF   4UYG   4UYH   5BT5   5DFB   5DFC   5DFD   5DW1   5HEL   5HEM   5HEN   5HFQ   5IBN   5IG6  

Gene RIF (43)

PMID Text
26586120 LRP1B, BRD2 and CACNA1D are new candidate genes in fetal metabolic programming of newborns exposed to maternal hyperglycemia.
26324948 This study implicates BET Brds as important regulators of IkappaB kinase/NF-kappaB-mediated synovial inflammation of RA and identifies BET proteins as novel therapeutic targets in inflammatory arthritis.
25049379 An unexpected role for the bromodomain and extraterminal domain (BET) proteins BRD2 and BRD4 in maintaining oncogenic IKK activity in activated B-cell-like diffuse large B-cell lymphoma.
24733848 BET proteins, particularly Brd2 and Brd4, may play a key role in the regulation of Nrf2-dependent antioxidant gene transcription and are hence an important target for augmenting antioxidant responses in oxidative stress-mediated diseases.
24146614 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24049186 BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration.
24048450 The C-terminal domain of Brd2 is important for chromatin interaction and regulation of transcription and alternative splicing.
23756480 The SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myoclonic epilepsy'
23255218 our results identify BRD2 as a new Tat-independent suppressor of HIV transcription in latently infected cells and underscore the therapeutic potential of BET inhibitors in the reversal of HIV latency.
23115324 Brd2 and Brd4 proteins mediatE the responses of LFs after growth factor stimulation and drivE the induction of lung fibrosis in mice in response to bleomycin challenge.
More...

AA Sequence

MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPK      1 - 70
KPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASE     71 - 140
CMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVT    141 - 210
SAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVK    211 - 280
RKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQL    281 - 350
KHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL    351 - 420
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEESSSESS    421 - 490
SEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA    491 - 560
EKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTG    561 - 630
YDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELE    631 - 700
RYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVA    701 - 770
VSRLSASSSSSDSSSSSSSSSSSDTSDSDSG                                           771 - 801
//

Text Mined References (69)

PMID Year Title
26586120 2015 LRP1B, BRD2 and CACNA1D: new candidate genes in fetal metabolic programming of newborns exposed to maternal hyperglycemia.
26324948 2016 Bromodomain and extra-terminal domain bromodomain inhibition prevents synovial inflammation via blocking I?B kinase-dependent NF-?B activation in rheumatoid fibroblast-like synoviocytes.
25049379 2014 Blockade of oncogenic I?B kinase activity in diffuse large B-cell lymphoma by bromodomain and extraterminal domain protein inhibitors.
24733848 2014 Bromodomain and extraterminal proteins suppress NF-E2-related factor 2-mediated antioxidant gene expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24229708 2013 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
24146614 2013 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24049186 2013 Bromo- and extraterminal domain chromatin regulators serve as cofactors for murine leukemia virus integration.
24048450 2013 The C-terminal domain of Brd2 is important for chromatin interaction and regulation of transcription and alternative splicing.
23756480 2013 The quest for juvenile myoclonic epilepsy genes.
More...