Property Summary

NCBI Gene PubMed Count 18
Grant Count 16
R01 Count 6
Funding $4,976,147.17
PubMed Score 65.16
PubTator Score 34.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
ulcerative colitis -1.200 0.000

Gene RIF (8)

PMID Text
26519030 3-Mercaptopyruvate sulphurtransferase and not cystathionine gamma-lyase is the primary regulator of coronary artery hydrogen sulfide production and function.
25487919 In this review, we discuss the roles of non-canonical Hippo/Mst signaling pathways in lymphocyte development and functions. [review]
25336638 distinct roles of each TUM1 isoform in the sulfur transfer processes in the cell
23698001 The crystal structure analysis allows us to propose a detailed mechanism for MST in which an Asp-His-Ser catalytic triad is positioned to activate the nucleophilic cysteine residue and participate in general acid-base chemistry
20877624 Observational study of gene-disease association. (HuGE Navigator)
20446008 In all the investigated cell lines, the activity of MPST was higher than that of CST, which suggests that in these cells, the main pathway of sulfane sulfur formation is the MPST-catalyzed reaction.
19695240 Data suggest that impaired rhodanese expression is associated with increased whole cell reactive oxygen species as well as higher mitochondrial superoxide production and predicts mortality in hemodialysis patients.
16545926 This work is the first report of a functional genetic polymorphism affecting MPST and should help in investigation of disorders such as mercaptolactate-cysteine disulfiduria.

AA Sequence

MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTS      1 - 70
PYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNL     71 - 140
PLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVN    141 - 210
IPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY    211 - 280
MRARPEDVISEGRGKTH                                                         281 - 297
//

Text Mined References (26)

PMID Year Title
26519030 2016 MPST but not CSE is the primary regulator of hydrogen sulfide production and function in the coronary artery.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25487919 2015 The non-canonical Hippo/Mst pathway in lymphocyte development and functions.
25336638 2014 Characterization and interaction studies of two isoforms of the dual localized 3-mercaptopyruvate sulfurtransferase TUM1 from humans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23698001 2013 Structure and kinetic analysis of H2S production by human mercaptopyruvate sulfurtransferase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
More...