Property Summary

NCBI Gene PubMed Count 18
PubMed Score 72.40
PubTator Score 34.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.0e-04
sonic hedgehog group medulloblastoma 1.400 3.5e-05
ulcerative colitis -1.200 2.6e-06

Gene RIF (8)

AA Sequence

MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTS      1 - 70
PYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNL     71 - 140
PLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVN    141 - 210
IPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY    211 - 280
MRARPEDVISEGRGKTH                                                         281 - 297
//

Text Mined References (26)

PMID Year Title