Property Summary

NCBI Gene PubMed Count 54
Grant Count 14
R01 Count 5
Funding $817,748.89
PubMed Score 99.49
PubTator Score 51.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytoma -1.300 0.006
psoriasis -2.000 0.000
osteosarcoma -1.399 0.000
group 3 medulloblastoma 1.400 0.007
atypical teratoid / rhabdoid tumor -1.200 0.000
adult high grade glioma -1.100 0.002
aldosterone-producing adenoma -1.244 0.017
subependymal giant cell astrocytoma -1.338 0.049
ovarian cancer -2.100 0.000

Gene RIF (17)

PMID Text
26509926 Presence of NF-Y transcription factor plays a pivotal role in transcriptional regulation of ID genes in development.
26039627 NF-YB transcription factor was identified as a novel direct E2F1 target.
23595228 The NF-Y complex is asymmetric, with NF-YB binding approximately 15 bp downstream from the CCAAT motif.
23332751 The crystal structure of NF-Y bound to a 25 bp CCAAT oligonucleotide shows that the histone-fold domains dimer binds to the DNA sugar-phosphate backbone, mimicking the nucleosome H2A/H2B-DNA assembly; NF-YA both binds to NF-YB/NF-YC and inserts an alpha helix deeply into the DNA minor groove, providing sequence-specific contacts to the CCAAT box.
22132193 Transcriptional repression mediated by IER5 regulates Cdc25B expression levels via the release of NF-YB and p300 in acute myeloid leukemia.
21445285 NF-Y acts upstream of H3K4me3 deposition by recruiting Ash2L
21252292 MicroRNA-485-3p regulates drug responsiveness by decreasing nuclear factor-YB expression, which in turn negatively regulates DNA topoisomerase IIalpha.
20965718 Observational study of gene-disease association. (HuGE Navigator)
18480411 CBF-A is a novel transacting factor required for cytoplasmic mRNA transport and localization
18275041 trichostatin A activates the transcription of TSP1 gene through the binding of transcription factor CBF to CCAAT box and the enhanced histone acetylation.
More...

AA Sequence

MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN      1 - 70
AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK     71 - 140
FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS       141 - 207
//

Text Mined References (56)

PMID Year Title
26509926 2015 Epigenetic role of CCAAT box-binding transcription factor NF-Y on ID gene family in human embryonic carcinoma cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26039627 2015 E2F1-Mediated Induction of NFYB Attenuates Apoptosis via Joint Regulation of a Pro-Survival Transcriptional Program.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
23734815 2013 Fludarabine treatment favors the retention of miR-485-3p by prostate cancer cells: implications for survival.
23595228 2013 NF-Y coassociates with FOS at promoters, enhancers, repetitive elements, and inactive chromatin regions, and is stereo-positioned with growth-controlling transcription factors.
23332751 2013 Sequence-specific transcription factor NF-Y displays histone-like DNA binding and H2B-like ubiquitination.
22132193 2011 Transcriptional repression of Cdc25B by IER5 inhibits the proliferation of leukemic progenitor cells through NF-YB and p300 in acute myeloid leukemia.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...