Property Summary

NCBI Gene PubMed Count 55
PubMed Score 104.83
PubTator Score 51.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-03
aldosterone-producing adenoma -1.244 1.7e-02
astrocytic glioma -1.200 4.5e-02
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
group 3 medulloblastoma 1.400 7.4e-03
malignant mesothelioma -1.200 1.1e-06
osteosarcoma -1.153 2.3e-02
ovarian cancer -2.100 4.0e-07
psoriasis -1.300 1.0e-09
subependymal giant cell astrocytoma -1.338 4.9e-02

Protein-protein Interaction (2)

Gene RIF (18)

AA Sequence

MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN      1 - 70
AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK     71 - 140
FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS       141 - 207
//

Text Mined References (57)

PMID Year Title