Property Summary

NCBI Gene PubMed Count 79
Grant Count 5
Funding $48,362.17
PubMed Score 94.20
PubTator Score 100.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P25205 B4DWW4 Q92660 Q9BTR3 Q9NUE7
Symbols HCC5
P1.h
RLFB
P1-MCM3

Gene

Gene RIF (28)

PMID Text
26504025 High MCM-3 expression correlated with Cutaneous T-cell Lymphomas.
25809478 normal DNA replication and replication checkpoint activation is regulated through the novel phosphorylation of MCM3 by Chk1
25046975 Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome.
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
24344040 Expression of KB cell MCM3 was not affected by doxorubicin.
24324072 present study aimed to investigate the relationship between expression of minichromosome maintenance proteins (MCM-3, MCM-7), metallothioneins (MT-I/II, MT-III), and Ki-67 in 103 ovarian cancer cases, mostly of the serous histological type
23886132 High MCM3 expression is associated with mucoepidermoid carcinomas and adenoid cystic carcinomas in salivary gland tumors.
23821456 The relatively lower MCM3 protein expression in FVPTC.
23821456 Relatively lower MCM3 protein expression in follicular variant of papillary thyroid carcinoma comparing to classical type could be due to a different tumorigenic pathway favored in this type of tissue.
23364796 HIV-1 Tat upregulates the expression of minichromosome maintenance complex component 3 (MCM3) in Jurkat cells
More...

AA Sequence

MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAF      1 - 70
EELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPK     71 - 140
VVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPA    141 - 210
GQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAED    211 - 280
IAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA    281 - 350
KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT    351 - 420
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMD    421 - 490
PEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKE    491 - 560
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK    561 - 630
ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK    631 - 700
DGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTE    701 - 770
SINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI                                    771 - 808
//

Text Mined References (94)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26504025 2015 Expression of MCM-3 and MCM-7 in Primary Cutaneous T-cell Lymphomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25809478 2015 Phosphorylation of Minichromosome Maintenance 3 (MCM3) by Checkpoint Kinase 1 (Chk1) Negatively Regulates DNA Replication and Checkpoint Activation.
25046975 2014 Minichromosome Maintenance (MCM) Family as potential diagnostic and prognostic tumor markers for human gliomas.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24344040 In vitro study on the effect of doxorubicin on the proliferation markers MCM3 and Ki-67.
24324072 2013 Comparison of minichromosome maintenance proteins (MCM-3, MCM-7) and metallothioneins (MT-I/II, MT-III) expression in relation to clinicopathological data in ovarian cancer.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
More...