Tbio | DNA replication licensing factor MCM3 |
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation.
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]
Comments
Disease | Target Count | P-value |
---|---|---|
glioblastoma multiforme | 347 | 6.65726035086315E-23 |
non-small cell lung cancer | 2798 | 1.37296705806225E-12 |
posterior fossa group A ependymoma | 1511 | 8.94305626259036E-8 |
malignant mesothelioma | 3163 | 1.06039470567529E-7 |
atypical teratoid / rhabdoid tumor | 4369 | 1.10959322305149E-6 |
group 3 medulloblastoma | 2254 | 2.79525942149546E-6 |
medulloblastoma, large-cell | 6234 | 3.26531815863131E-6 |
pediatric high grade glioma | 2712 | 1.15577031277277E-5 |
lung cancer | 4473 | 1.41861390512543E-5 |
primitive neuroectodermal tumor | 3031 | 2.12609933002616E-4 |
colon cancer | 1475 | 2.44195205282538E-4 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 9.40435724391326E-4 |
adrenocortical carcinoma | 1427 | 0.0018253887789393 |
Breast cancer | 3099 | 0.0260219833290876 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 1.600 | 0.000 |
glioblastoma multiforme | 1.300 | 0.000 |
group 3 medulloblastoma | 2.100 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.600 | 0.000 |
medulloblastoma, large-cell | 2.000 | 0.000 |
primitive neuroectodermal tumor | 1.400 | 0.000 |
adrenocortical carcinoma | 1.074 | 0.002 |
non-small cell lung cancer | 1.049 | 0.000 |
intraductal papillary-mucinous carcinoma... | 1.500 | 0.001 |
lung cancer | 2.200 | 0.000 |
colon cancer | 1.300 | 0.000 |
Breast cancer | 2.500 | 0.026 |
pediatric high grade glioma | 1.300 | 0.000 |
posterior fossa group A ependymoma | 1.100 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Zebrafish | OMA Inparanoid |
C. elegans | OMA Inparanoid |
Fruitfly | OMA EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26504025 | High MCM-3 expression correlated with Cutaneous T-cell Lymphomas. |
25809478 | normal DNA replication and replication checkpoint activation is regulated through the novel phosphorylation of MCM3 by Chk1 |
25046975 | Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome. |
24386425 | Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression. |
24344040 | Expression of KB cell MCM3 was not affected by doxorubicin. |
24324072 | present study aimed to investigate the relationship between expression of minichromosome maintenance proteins (MCM-3, MCM-7), metallothioneins (MT-I/II, MT-III), and Ki-67 in 103 ovarian cancer cases, mostly of the serous histological type |
23886132 | High MCM3 expression is associated with mucoepidermoid carcinomas and adenoid cystic carcinomas in salivary gland tumors. |
23821456 | The relatively lower MCM3 protein expression in FVPTC. |
23821456 | Relatively lower MCM3 protein expression in follicular variant of papillary thyroid carcinoma comparing to classical type could be due to a different tumorigenic pathway favored in this type of tissue. |
23364796 | HIV-1 Tat upregulates the expression of minichromosome maintenance complex component 3 (MCM3) in Jurkat cells |
More... |
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAF 1 - 70 EELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPK 71 - 140 VVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPA 141 - 210 GQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAED 211 - 280 IAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA 281 - 350 KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT 351 - 420 AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMD 421 - 490 PEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKE 491 - 560 KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK 561 - 630 ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK 631 - 700 DGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTE 701 - 770 SINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI 771 - 808 //
PMID | Year | Title |
---|---|---|
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26504025 | 2015 | Expression of MCM-3 and MCM-7 in Primary Cutaneous T-cell Lymphomas. |
26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
25809478 | 2015 | Phosphorylation of Minichromosome Maintenance 3 (MCM3) by Checkpoint Kinase 1 (Chk1) Negatively Regulates DNA Replication and Checkpoint Activation. |
25046975 | 2014 | Minichromosome Maintenance (MCM) Family as potential diagnostic and prognostic tumor markers for human gliomas. |
25036637 | 2014 | A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways. |
24386425 | 2013 | Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma. |
24344040 | In vitro study on the effect of doxorubicin on the proliferation markers MCM3 and Ki-67. | |
24324072 | 2013 | Comparison of minichromosome maintenance proteins (MCM-3, MCM-7) and metallothioneins (MT-I/II, MT-III) expression in relation to clinicopathological data in ovarian cancer. |
24299456 | 2014 | Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7. |
More... |