Property Summary

NCBI Gene PubMed Count 85
PubMed Score 101.52
PubTator Score 100.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.074 1.8e-03
atypical teratoid / rhabdoid tumor 1.600 1.1e-06
Breast cancer 2.500 2.6e-02
colon cancer 1.300 2.4e-04
glioblastoma 1.300 5.4e-08
group 3 medulloblastoma 2.100 2.8e-06
intraductal papillary-mucinous carcinoma... 1.500 9.4e-04
lung cancer 1.500 3.0e-02
malignant mesothelioma 1.600 1.1e-07
medulloblastoma, large-cell 2.000 3.3e-06
non-small cell lung cancer 1.049 1.4e-12
pediatric high grade glioma 1.300 1.2e-05
posterior fossa group A ependymoma 1.100 8.9e-08
primitive neuroectodermal tumor 1.400 2.1e-04

Protein-protein Interaction (9)

Gene RIF (33)

AA Sequence

MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAF      1 - 70
EELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPK     71 - 140
VVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPA    141 - 210
GQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAED    211 - 280
IAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA    281 - 350
KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT    351 - 420
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMD    421 - 490
PEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKE    491 - 560
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK    561 - 630
ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK    631 - 700
DGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTE    701 - 770
SINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI                                    771 - 808
//

Text Mined References (100)

PMID Year Title