Property Summary

NCBI Gene PubMed Count 339
PubMed Score 534.62
PubTator Score 701.28

Knowledge Summary

Patent (77,288)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
astrocytoma 1493 4.70090575480309E-27
posterior fossa group A ependymoma 1511 2.5456901067141E-19
oligodendroglioma 2849 1.21975201888643E-16
pediatric high grade glioma 2712 7.81058306162154E-11
atypical teratoid / rhabdoid tumor 4369 1.4848382123285E-10
sonic hedgehog group medulloblastoma 1482 9.99822302137788E-10
pilocytic astrocytoma 3086 7.45230925773961E-9
glioblastoma 5572 7.56838714798177E-9
medulloblastoma, large-cell 6234 1.10202324569889E-7
ulcerative colitis 2087 1.58790146781351E-7
primitive neuroectodermal tumor 3031 3.68549391658433E-7
interstitial cystitis 2299 1.58078798200227E-5
nasopharyngeal carcinoma 1056 2.84918227161072E-5
osteosarcoma 7933 3.51499903967141E-4
primary Sjogren syndrome 789 5.35158899657126E-4
ovarian cancer 8492 0.00293207338650811
gastric carcinoma 832 0.00517349063969526
primary pancreatic ductal adenocarcinoma 1271 0.0216912949415533
esophageal adenocarcinoma 737 0.0257644123855324
acute myeloid leukemia 785 0.0393345380918712
head and neck cancer 270 0.0427189215046717

Expression

Synonym

Accession P25116 Q53XV0 Q96RF7 Q9BUN4 PAR-1
Symbols TR
HTR
CF2R
PAR1
PAR-1

Gene

F2R

PANTHER Protein Class (2)

PDB

1NRN   1NRO   1NRP   1NRQ   1NRR   3BEF   3HKI   3HKJ   3LU9   3VW7  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652255 confirmatory 1 / 0 / 1 Discovery of Novel Antagonists of Protease activated receptor 4: PAR 1 Selectivity CRC Assay

Gene RIF (295)

PMID Text
27023670 These results suggest that stabilization of microtubule-unbound tau by phosphorylation at Ser262/356 via the PAR-1/MARK may act in the initial steps of tau mismetabolism in AD pathogenesis
26875892 The serum levels of PAR1 might have a diagnostic value in lung cancer patients
26729042 Thrombin and the PAR-1 activating peptide, TFLLR, lead to the phosphorylation of eNOS-Ser-1177 in human coronary artery endothelial cells, which was blocked by SCH-79797 (SCH), a PAR-1 inhibitor.
26681756 PZ-128 is a promising antiplatelet agent that provides rapid, specific, dose dependent, and reversible inhibition of platelet protease-activated receptor-1 through a novel intracellular mechanism.
26635365 Rab11A and Rab11B differentially regulate intracellular trafficking of PAR1 through distinct endosomal sorting mechanisms
26600192 Binding of the PH domain of PAR-1 enables breast cancer growth and extravillous trophoblast invasion.
26475502 thrombin/PAR-1 interaction regulated MCP-1, TF, MCSF and IL-6 production.
26424552 conjugation of a peptide fragment derived from the third intracellular loop (i3) of the protease-activated receptor 1 (PAR1) to a peptide that can selectively target tumours
26283733 The data reveal a new proprotein convertases -PAR-1-interaction pathway, which offsets the effects of HIV-induced neuroinflammation, viral infection, and potentially the development of HIV-Associated Neurocognitive Disorder.
26283733 F2R (PAR1) DOES NOT block processing of Vpr by soluble PCSK6 (PACE4)
More...

AA Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR      1 - 70
LVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY     71 - 140
MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS    141 - 210
LSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF    211 - 280
VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY    281 - 350
FAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY    351 - 420
KKLLT                                                                     421 - 425
//

Text Mined References (341)

PMID Year Title
27023670 2016 Stabilization of Microtubule-Unbound Tau via Tau Phosphorylation at Ser262/356 by Par-1/MARK Contributes to Augmentation of AD-Related Phosphorylation and A?42-Induced Tau Toxicity.
26875892 2016 Clinical significance of serum protease activated receptor1 levels in patients with lung cancer.
26729042 2016 Featured Article: Differential regulation of endothelial nitric oxide synthase phosphorylation by protease-activated receptors in adult human endothelial cells.
26681756 2016 Cell-Penetrating Pepducin Therapy Targeting PAR1 in Subjects With Coronary Artery Disease.
26635365 2016 Recycling and Endosomal Sorting of Protease-activated Receptor-1 Is Distinctly Regulated by Rab11A and Rab11B Proteins.
26600192 2015 PH motifs in PAR1&2 endow breast cancer growth.
26475502 2016 Thrombin induced by the extrinsic pathway and PAR-1 regulated inflammation at the site of fracture repair.
26424552 2015 Down-regulation of PAR1 activity with a pHLIP-based allosteric antagonist induces cancer cell death.
26283733 2015 Neuroinflammation-Induced Interactions between Protease-Activated Receptor 1 and Proprotein Convertases in HIV-Associated Neurocognitive Disorder.
26278396 2015 Role of a functional polymorphism in the F2R gene promoter in sarcoidosis.
More...