Property Summary

NCBI Gene PubMed Count 152
Grant Count 93
R01 Count 69
Funding $7,651,597.33
PubMed Score 81.43
PubTator Score 166.49

Knowledge Summary

Patent (16,864)

Expression

Synonym

Accession P25106 A8K6J4 Q53RV4 Q8NE10 Q92938 Q92986
Symbols RDC1
CXCR7
RDC-1
CMKOR1
CXC-R7
CXCR-7
GPR159

Gene

Gene RIF (137)

PMID Text
26780310 Dimers CXCR4 and CXCR7 are involved in TFF3-dependent activation of cell migration, but not cell proliferation. The ERK1/2 pathway is activated in the process, but not influenced by CXCR4 or CXCR7.
26741980 CXCR7 is expressed on NogoA- and Nkx2.2-positive oligodendroglial cells in human multiple sclerosis brains.
26722521 Expression levels of CXCR4 and CXCR7 in breast cancer tissues were significantly higher than that in adjacent normal tissues and patients with high CXCR4 and CXCR7 expression had a shorter survival time compared with those with low expression.
26722500 CXCR7 expression in colorectal carcinoma was correlated with tumor development and poor prognosis of patients.
26721717 the roles of CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and may be linked to the occurrence and development of severe preeclampsia
26551719 Data shows the relative expression of CXCR4 and CXCR7 in platelets, their dynamic trafficking, how they differentially mediate the functional and survival response to some chemokines, and their prognostic value in coronary artery disease. [review]
26507929 Pioglitazone-mediated CXCR7 suppression and macrophage chemotaxis inhibition occur via activating peroxisome proliferator-activated receptor gamma.
26428435 Data indicate that CXC chemokine CXCL14, CXC chemokine receptor CXCR7 and the ratio between CXC chemokine receptor CXCR4-2 and CXCR4-1 could predict diseae free survival in Ewing sarcoma patients.
26413813 Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement.
26360780 STAT3 signaling downstream of CXCR7 is involved in miR-101 regulation of breast cancer cell behaviors.
More...

AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNI      1 - 70
QAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSV     71 - 140
DRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLI    141 - 210
GMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSIL    211 - 280
HYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVS    281 - 350
ETEYSALEQSTK                                                              351 - 362
//

Text Mined References (160)

PMID Year Title
26780310 2016 CXCR4 and CXCR7 Mediate TFF3-Induced Cell Migration Independently From the ERK1/2 Signaling Pathway.
26741980 2016 CXCR7 Is Involved in Human Oligodendroglial Precursor Cell Maturation.
26722521 2015 Prognostic significance of CXCL12, CXCR4, and CXCR7 in patients with breast cancer.
26722500 2015 Expression of chemokine receptor CXCR7 in colorectal carcinoma and its prognostic significance.
26721717 2016 CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and linked to pathophysiology of severe preeclampsia.
26551719 2015 Role of chemokine receptors CXCR4 and CXCR7 for platelet function.
26507929 2015 Pioglitazone Suppresses CXCR7 Expression To Inhibit Human Macrophage Chemotaxis through Peroxisome Proliferator-Activated Receptor ?.
26428435 2015 CXCL14, CXCR7 expression and CXCR4 splice variant ratio associate with survival and metastases in Ewing sarcoma patients.
26413813 2015 GLI1 orchestrates CXCR4/CXCR7 signaling to enhance migration and metastasis of breast cancer cells.
26360780 2015 MiRNA-101 inhibits breast cancer growth and metastasis by targeting CX chemokine receptor 7.
More...