Property Summary

Ligand Count 225
NCBI Gene PubMed Count 85
PubMed Score 116.14
PubTator Score 254.01

Knowledge Summary

Patent (8,806)

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 1.146 2.1e-02
Amyotrophic lateral sclerosis -1.089 1.5e-03
cystic fibrosis 1.100 2.4e-04
fascioscapulohumeral muscular dystrophy -1.100 6.7e-04
gastric carcinoma 1.300 1.8e-02
hepatocellular carcinoma 1.300 2.1e-05
interstitial cystitis 1.100 2.4e-03
juvenile dermatomyositis -1.143 6.1e-07
medulloblastoma, large-cell -1.300 1.0e-04
mucosa-associated lymphoid tissue lympho... 1.052 7.9e-03
osteosarcoma -1.066 7.7e-03
ovarian cancer -1.400 1.1e-05
pancreatic cancer 1.900 1.2e-04
pancreatic carcinoma 1.900 1.2e-04
psoriasis 1.500 5.9e-03
tuberculosis 1.100 1.0e-05

Gene RIF (56)

AA Sequence

MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLTMADMLFLITL      1 - 70
PLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQANTRKRGISLSLV     71 - 140
IWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKGSVPVLIIHIFIVFSFFLVFLIILFCNLVII    141 - 210
RTLLMQPVQQQRNAEVKRRALWMVCTVLAVFIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLC    211 - 280
LLSTNCVLDPVIYCFLTKKFRKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN            281 - 342
//

Text Mined References (86)

PMID Year Title