Property Summary

Ligand Count 1,835
NCBI Gene PubMed Count 169
PubMed Score 1237.97
PubTator Score 925.00

Knowledge Summary

Patent (48,655)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.7e-03
Breast cancer -3.100 2.9e-02
ductal carcinoma in situ -1.500 1.1e-03
glioblastoma 1.100 1.9e-03
group 4 medulloblastoma -1.100 9.5e-03
invasive ductal carcinoma -1.900 1.9e-03
medulloblastoma, large-cell 1.400 1.0e-04
osteosarcoma -1.870 8.1e-09

 GWAS Trait (1)

Gene RIF (138)

AA Sequence

MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYF      1 - 70
LVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQP     71 - 140
RLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLL    141 - 210
VIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLK    211 - 280
KFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYK    281 - 350
VSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS                 351 - 407
//

Text Mined References (172)

PMID Year Title