Property Summary

Ligand Count 706
NCBI Gene PubMed Count 191
PubMed Score 644.56
PubTator Score 1930.88

Knowledge Summary

Patent (39,709)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Dental caries 164 0.0 2.4
Intracranial aneurysm 24 0.0 3.0

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma 1.400 3.5e-03
astrocytic glioma 1.700 4.6e-03
Astrocytoma, Pilocytic 2.000 5.5e-06
atypical teratoid / rhabdoid tumor 2.000 4.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.029 1.0e-02
Breast cancer 2.900 2.3e-02
colon cancer 1.300 5.0e-02
cystic fibrosis -1.574 8.9e-04
Endometriosis 1.448 3.7e-02
ependymoma 1.300 4.6e-04
gastric carcinoma 2.300 1.7e-02
glioblastoma 1.300 2.2e-03
interstitial cystitis -1.700 5.8e-03
intraductal papillary-mucinous adenoma (... -2.100 1.2e-02
intraductal papillary-mucinous carcinoma... -2.200 2.5e-02
invasive ductal carcinoma 1.899 7.5e-04
lung adenocarcinoma -1.098 4.2e-04
lung cancer -1.600 3.6e-03
malignant mesothelioma -1.400 1.1e-04
medulloblastoma, large-cell 1.300 3.2e-02
non-small cell lung cancer -1.116 8.2e-07
oligodendroglioma 1.200 2.8e-09
osteosarcoma 3.988 2.0e-03
ovarian cancer -1.700 2.2e-05
pancreatic cancer 1.700 1.8e-03
Pick disease 1.800 2.4e-04
primary pancreatic ductal adenocarcinoma 2.478 7.7e-04
psoriasis 1.300 1.7e-04
ulcerative colitis 1.200 1.9e-02
X-linked cerebral adrenoleukodystrophy 1.600 2.9e-02

Protein-protein Interaction (12)

Gene RIF (169)

AA Sequence

METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCP      1 - 70
QQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK     71 - 140
LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIW    141 - 210
ILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTC    211 - 280
EMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLM    281 - 350
DYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS    351 - 420
SHKDSMN                                                                   421 - 427
//

Text Mined References (194)

PMID Year Title