Property Summary

NCBI Gene PubMed Count 43
Grant Count 179
R01 Count 88
Funding $85,737,945.42
PubMed Score 175.19
PubTator Score 2944.59

Knowledge Summary

Patent (29,235)

Expression

Synonym

Accession P25100 Q9NPY0
Symbols DAR
ADRA1
ADRA1A
ADRA1R
ALPHA1
dJ779E11.2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity

Gene RIF (28)

PMID Text
26381449 This study showed that ADRA1D gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.
25481381 Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation.
24844469 alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts.
23877383 Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively.
23205498 alpha(1)(D)-adrenoceptors in the lower urinary tract might play an important role in the pathophysiology of lower urinary tract disorders. [review]
21115837 Data show that alpha-dystrobrevin-1 recruits alpha-catulin, which supersensitizes alpha(1D)-AR functional responses by recruiting effector molecules to the signalosome.
21063774 Genetic characteristics associated with response to domperidone therapy included polymorphisms in the drug transporter gene ABCB1, the potassium channel KCNH2 gene, and alpha1D--adrenoceptor ADRA1D gene.
21063774 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAGSGEDNRSSAG      1 - 70
EPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAV     71 - 140
ADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTE    141 - 210
RKAAAILALLWVVALVVSVGPLLGWKEPVPPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVV    211 - 280
ARSTTRSLEAGVKRERGKASEVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTL    281 - 350
AIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ    351 - 420
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKP    421 - 490
PSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYE    491 - 560
LADYSNLRETDI                                                              561 - 572
//

Text Mined References (43)

PMID Year Title
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
26381449 2015 The association of DNA methylation and brain volume in healthy individuals and schizophrenia patients.
25481381 2014 Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation.
24844469 2014 The stimulatory effects of alpha1-adrenergic receptors on TGF-beta1, IGF-1 and hyaluronan production in human skin fibroblasts.
23877383 2013 The presence and distribution of alpha adrenergic receptors in human renal pelvis and calyces.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23205498 2013 Male lower urinary tract symptoms and ?1D-adrenoceptors.
21115837 2010 Alpha-dystrobrevin-1 recruits alpha-catulin to the alpha1D-adrenergic receptor/dystrophin-associated protein complex signalosome.
21063774 2011 Domperidone treatment for gastroparesis: demographic and pharmacogenetic characterization of clinical efficacy and side-effects.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...