Property Summary

NCBI Gene PubMed Count 42
Grant Count 49
R01 Count 32
Funding $8,825,888.59
PubMed Score 196.49
PubTator Score 301.18

Knowledge Summary

Patent (28,673)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 2.300 0.033
lung carcinoma 1.700 0.000
ulcerative colitis -1.300 0.001

Gene RIF (29)

PMID Text
26773096 Findings show how caloric suppression of the guanylin-GUCY2C signaling axis links obesity to negation of a universal tumor suppressor pathway in colorectal cancer.
25370039 Data show that individuals affected with meconium ileus (MI) had either homozygous or compound heterozygous variants in enterotoxin receptor GUCY2C.
25064385 Transmission disequilibrium tests (TDT), case-control studies and quantitative analyses indicated association between GUC2C with Attention-deficit/hyperactivitydisorder and its core symptoms.
24919572 High guanylyl cyclase C expression is associated with colon cancer recurrence.
24217248 Intestinal cell proliferation and senescence are regulated by receptor guanylyl cyclase C and p21.
24085786 GUCY2C signaling constitutes a direct link between the initiation of colorectal cancer and the induction of its associated desmoplastic stromal niche.
23269669 Interaction with VIP36 is dependent on glycosylation at the same sites that allow GC-C to fold and bind ligand.
23150200 Data show that lower survival (OS) and disease-free survival (DFS) rates were significantly associated with guanylate cyclase C (GCC) and CK20 mRNA levels.
22521417 Mutations in GUCY2C were associated with the Meconium ileus phenotype. downregulation of GUCY2C leads to a cystic fibrosis-like intestinal phenotype.
22436048 We identified a heterozygous missense mutation (c.2519G-->T) in GUCY2C in all family members with familial diarrhea syndrome.
More...

AA Sequence

MKTLLLDLALWSLLFQPGWLSFSSQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQ      1 - 70
NAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYLDTELSYP     71 - 140
MISAGSFGLSCDYKETLTRLMSPARKLMYFLVNFWKTNDLPFKTYSWSTSYVYKNGTETEDCFWYLNALE    141 - 210
ASVSYFSHELGFKVVLRQDKEFQDILMDHNRKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQY    211 - 280
FEDNVTAPDYMKNVLVLTLSPGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLKIFLENGENITTPK    281 - 350
FAHAFRNLTFEGYDGPVTLDDWGDVDSTMVLLYTSVDTKKYKVLLTYDTHVNKTYPVDMSPTFTWKNSKL    351 - 420
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYRKDYELRQKKWSHIPPENIFPLETNETNHVSLK    421 - 490
IDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQIDYYNLTKFYGTVKLDTMIFGV    491 - 560
IEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKI    561 - 630
TDFGCNSILPPKKDLWTAPEHLRQANISQKGDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNG    631 - 700
MKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQL    701 - 770
YSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS    771 - 840
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELE    841 - 910
HLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFL    911 - 980
YEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRV    981 - 1050
ASYKKGTLEYLQLNTTDKESTYF                                                  1051 - 1073
//

Text Mined References (46)

PMID Year Title
26773096 2016 Obesity-Induced Colorectal Cancer Is Driven by Caloric Silencing of the Guanylin-GUCY2C Paracrine Signaling Axis.
25370039 2015 Meconium ileus in a Lebanese family secondary to mutations in the GUCY2C gene.
25064385 2014 Association between GUC2C and ADHD: evidence from both categorical and quantitative traits.
24919572 2014 Molecular testing for lymph node metastases as a determinant of colon cancer recurrence: results from a retrospective multicenter study.
24217248 2014 Intestinal cell proliferation and senescence are regulated by receptor guanylyl cyclase C and p21.
24085786 2013 Intestinal GUCY2C prevents TGF-? secretion coordinating desmoplasia and hyperproliferation in colorectal cancer.
23269669 2013 Site-specific N-linked glycosylation of receptor guanylyl cyclase C regulates ligand binding, ligand-mediated activation and interaction with vesicular integral membrane protein 36, VIP36.
23150200 2013 Detection of circulating tumor cells in peripheral blood of colorectal cancer patients without distant organ metastases.
22521417 2012 Meconium ileus caused by mutations in GUCY2C, encoding the CFTR-activating guanylate cyclase 2C.
22436048 2012 Familial diarrhea syndrome caused by an activating GUCY2C mutation.
More...