Property Summary

NCBI Gene PubMed Count 23
Grant Count 12
R01 Count 7
Funding $1,051,572.25
PubMed Score 21.62
PubTator Score 33.25

Knowledge Summary

Patent (14,115)

Expression

 GWAS Trait (1)

Gene RIF (15)

PMID Text
24067461 The H. pylori-derived peptide Hp(2-20) stimulated eosinophil migration through the engagement of FPR2 and FPR3, and also induced production of VEGF-A and TGF-beta, two key mediators of tissue remodelling.
23746112 The demonstrated proper folding and functionality of the cell-free produced human FPR3 opens a new avenue for the fast and efficient generation of human FPRs (and even other GPCRs) for structural and functional analysis.
21717223 transcriptional variations of FPR3 occur by an alternative promoter during primate evolution.
21709160 F2L peptide, derived from the processing of nanomolar concentrations of heme-binding protein (HEBP)1, is active on FPR3 and able to induce recruitment of FPR3-expressing monocytes, macrophages, and mouse neutrophils
21543323 N-formyl peptide receptor 3 (FPR3) departs from the homologous FPR2/ALX receptor with regard to the major processes governing chemoattractant receptor regulation, expression at the cell surface, and phosphorylation.
20972812 Results show that uPAR expression regulates the adhesive and migratory ability of CXCR4-expressing cells through a mechanism involving fMLP receptors and alpha-v integrins.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19843937 Human monocytes express FPR1, FPR2, and FPR3; human neutrophils express FPR1 and FPR2, but not FPR3.
19342677 FPRL2 is expressed and functional in macrophages differentiated from monocytes in vitro in different conditions
17577578 However, F2L inhibits formyl peptide receptor (FPR) and FPRL1 activities, resulting in the inhibition of intracellular calcium increases, and superoxide generation induced by N-formyl-Met-Leu-Phe, MMK-1, or Trp-Lys-Tyr-Met-Val-d-Met in neutrophils.
More...

AA Sequence

METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVNTICYLNLALA      1 - 70
DFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIALDRCICVLHPAWAQNHRTMS     71 - 140
LAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNFAFWGDTAVERLNVFITMAKVFLILHFIIGF    141 - 210
SVPMSIITVCYGIIAAKIHRNHMIKSSRPLRVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKII    211 - 280
LVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETEL    281 - 350
QAM                                                                       351 - 353
//

Text Mined References (23)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24067461 Helicobacter pylori HP(2-20) induces eosinophil activation and accumulation in superficial gastric mucosa and stimulates VEGF-alpha and TGF-beta release by interacting with formyl-peptide receptors.
23746112 2013 Evaluation of cell-free expression system for the production of soluble and functional human GPCR N-formyl peptide receptors.
21717223 2011 Transcriptional variations mediated by an alternative promoter of the FPR3 gene.
21709160 2011 Processing of HEBP1 by cathepsin D gives rise to F2L, the agonist of formyl peptide receptor 3.
21543323 2011 N-formyl peptide receptor 3 (FPR3) departs from the homologous FPR2/ALX receptor with regard to the major processes governing chemoattractant receptor regulation, expression at the cell surface, and phosphorylation.
20972812 2011 The cross-talk between the urokinase receptor and fMLP receptors regulates the activity of the CXCR4 chemokine receptor.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19843937 2009 Functional expression of formyl peptide receptor family in human NK cells.
19342677 2009 Formyl peptide receptor-like 2 is expressed and functional in plasmacytoid dendritic cells, tissue-specific macrophage subpopulations, and eosinophils.
More...