Property Summary

NCBI Gene PubMed Count 35
PubMed Score 89.48
PubTator Score 97.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 3.0

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.200 2.1e-02
Astrocytoma, Pilocytic 2.200 5.3e-06
Breast cancer 1.200 2.8e-02
breast carcinoma 1.100 1.7e-02
ependymoma 2.700 3.1e-10
gastric carcinoma 1.500 2.3e-02
glioblastoma 1.800 3.6e-03
intraductal papillary-mucinous carcinoma... -1.100 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.0e-02
invasive ductal carcinoma 2.045 3.4e-04
lung cancer -1.100 3.3e-02
ovarian cancer 3.500 8.0e-05
pancreatic cancer 1.300 1.9e-03
pituitary cancer -1.200 4.0e-05

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPL      1 - 70
LPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQP     71 - 140
GLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGV    141 - 210
GQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGV    211 - 280
GVPGAAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGE    281 - 350
QGPQGLGGPPGLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPP    351 - 420
GPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLPGLKGEPGLPG    421 - 490
PPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETGIAGLHLPNGGVEGAVLGKGG    491 - 560
KPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKG    561 - 630
TNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLL    631 - 700
CPT                                                                       701 - 703
//

Text Mined References (38)

PMID Year Title