Property Summary

NCBI Gene PubMed Count 242
PubMed Score 0.00
PubTator Score 599.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 2.000 1.5e-03
astrocytic glioma 2.000 2.0e-03
Astrocytoma, Pilocytic -1.500 1.2e-04
atypical teratoid / rhabdoid tumor 2.300 1.6e-03
chronic lymphosyte leukemia 1.200 1.2e-03
cystic fibrosis 3.901 6.9e-08
ductal carcinoma in situ 3.000 4.5e-03
ependymoma 2.200 1.8e-02
glioblastoma 1.400 1.6e-02
group 3 medulloblastoma 3.400 3.5e-05
hepatocellular carcinoma 1.200 1.5e-02
interstitial cystitis -1.700 4.6e-03
invasive ductal carcinoma 2.700 3.3e-02
lung adenocarcinoma 2.137 4.3e-06
lung cancer 1.700 5.1e-05
malignant mesothelioma 5.900 7.1e-10
medulloblastoma, large-cell 3.000 1.6e-03
non-small cell lung cancer 1.499 3.4e-09
oligodendroglioma 1.700 2.5e-02
ovarian cancer 4.400 5.5e-11
pancreatic ductal adenocarcinoma liver m... 2.940 4.0e-03
pituitary cancer -1.500 4.3e-02
primitive neuroectodermal tumor 3.000 2.9e-03
psoriasis 1.600 4.7e-11
pterygium 1.600 4.7e-02
subependymal giant cell astrocytoma 2.539 4.4e-02

 Compartment GO Term (0)

Gene RIF (219)

AA Sequence

MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFV      1 - 70
VSLSLLHLYS                                                                 71 - 80
//

Text Mined References (242)

PMID Year Title