Property Summary

NCBI Gene PubMed Count 217
PubMed Score 0.00
PubTator Score 599.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Multiple Sclerosis 498
Disease Target Count P-value
psoriasis 6685 4.8859082907847E-211
posterior fossa group B ependymoma 1530 8.60558482341122E-12
ovarian cancer 8492 1.38079380456495E-11
malignant mesothelioma 3163 7.09178570593806E-9
group 4 medulloblastoma 1875 1.07479077087827E-8
non-small cell lung cancer 2798 1.30097655630399E-8
cystic fibrosis 1670 2.42772777342715E-8
lung cancer 4473 1.03822755521864E-5
lung adenocarcinoma 2714 2.91319048604128E-5
atypical teratoid/rhabdoid tumor 1095 7.42315705837199E-5
pilocytic astrocytoma 3086 9.57182137631335E-5
chronic lymphosyte leukemia 232 0.00110140633973045
astrocytic glioma 2241 0.0014523399553763
medulloblastoma, large-cell 6234 0.00156799179902723
adult high grade glioma 2148 0.00208229048882768
interstitial cystitis 2299 0.00319296377815901
primitive neuroectodermal tumor 3031 0.00356344901398206
ductal carcinoma in situ 1745 0.00446344638723006
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00651006031401356
hepatocellular carcinoma 550 0.0147746580401033
oligodendroglioma 2849 0.0171657880718747
invasive ductal carcinoma 2950 0.0248474715335457
pituitary cancer 1972 0.0403445924619908
subependymal giant cell astrocytoma 2287 0.0439140633588531
glioblastoma 5572 0.045381341917882
pterygium 74 0.047277236770148

Synonym

Accession P25063 Q16257 Q53XS0
Symbols CD24A

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Pig OMA Inparanoid

 Compartment GO Term (1)

Gene RIF (194)

PMID Text
26852663 The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia.
26830684 CD24 regulates EGFR signaling by inhibiting EGFR internalization and degradation in a RhoA-dependent manner in gastric cancer cells.
26718436 The functional CD24 A57V and TG/del polymorphisms are associated with susceptibility to multiple autoimmune diseases. (Meta-analysis)
26707501 our results suggest that CD24 is upregulated in cervical cancer tissues and plays its functions by affecting the MAPK signaling pathway in cervical cancer.
26647656 we present evidence that CD44v3 immunoexpression and CD44v3+/CD24- immunophenotypes could give prognostic information associated with unfavorable clinical outcomes.
26617852 CD44(+)/CD24(-) phenotype may be an important factor for malignant relapse following surgical resection and chemotherapy in patients with invasive ductal carcinoma.
26444008 CD24 gene expression was associated with histone acetylation.
26298632 Basal like tumors are enriched for cancer stem cells (CSC) with CD44(+)/CD24(-/low) phenotype. CD133 can detect a different population of CSC in breast carcinoma
26245161 Studied the relationship between two CD24 polymorphisms, rs8734/rs52812045 and rs3838646, and autoimmune disease.
26227486 The CD24-positive phenotype is associated with cisplatin resistance in endometrial cancer tumor xenografts and is accompanied by high expression of ABC transporters.
More...

AA Sequence

MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFV      1 - 70
VSLSLLHLYS                                                                 71 - 80
//

Text Mined References (217)

PMID Year Title
26852663 2016 Regulatory B cells (CD19(+)CD38(hi)CD24(hi)) in alloimmunized and non-alloimmunized children with ?-thalassemia major.
26830684 2016 CD24 associates with EGFR and supports EGF/EGFR signaling via RhoA in gastric cancer cells.
26718436 2015 Association between functional CD24 polymorphisms and susceptibility to autoimmune diseases: A meta-analysis.
26707501 2016 CD24 promotes the proliferation and inhibits the apoptosis of cervical cancer cells in vitro.
26647656 2016 CD44v3+/CD24- cells possess cancer stem cell-like properties in human oral squamous cell carcinoma.
26617852 2015 Predictive value of CD44 and CD24 for prognosis and chemotherapy response in invasive breast ductal carcinoma.
26444008 2015 CD24 Overexpression Is Associated with Poor Prognosis in Luminal A and Triple-Negative Breast Cancer.
26298632 2015 The clinicopathological and prognostic significance of CD24, CD44, CD133, ALDH1 expressions in invasive ductal carcinoma of the breast: CD44/CD24 expression in breast cancer.
26245161 2015 Contribution of CD24 polymorphisms to autoimmune disease: A meta-analysis.
26227486 2015 Met Signaling Cascade Is Amplified by the Recruitment of Phosphorylated Met to Lipid Rafts via CD24 and Leads to Drug Resistance in Endometrial Cancer Cell Lines.
More...