Property Summary

NCBI Gene PubMed Count 288
Grant Count 421
R01 Count 256
Funding $37,957,792.33
PubMed Score 671.36
PubTator Score 462.49

Knowledge Summary

Patent (57,672)

Expression

  Differential Expression (16)

Disease log2 FC p
ulcerative colitis 2.800 0.000
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.200 0.003
urothelial carcinoma -1.600 0.032
esophageal adenocarcinoma -1.400 0.026
psoriasis 2.700 0.000
cutaneous lupus erythematosus 2.200 0.000
osteosarcoma -3.327 0.006
tuberculosis 1.600 0.001
non-small cell lung cancer -2.539 0.000
lung cancer -3.500 0.000
colon cancer 1.100 0.004
pancreatic carcinoma 1.200 0.003
lung adenocarcinoma -1.500 0.000
lung carcinoma -2.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession P25025 Q8IUZ1 Q9P2T6 Q9P2T7 CXC-R2
Symbols CD182
IL8R2
IL8RA
IL8RB
CMKAR2
CDw128b

Gene

PDB

4Q3H  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (237)

PMID Text
26648969 The results of this study show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes.
26559818 Data show that trefoil factor-3 (TFF3) secreted from mammary carcinoma cells promotes de novo angiogenesis via interleukin-8 (IL-8)/IL-8 receptor CXCR2.
26521741 These studies provide direct evidence linking the activation of IL8, DNA demethylation and the induction of the OA process with important therapeutic implications therein for patients with this debilitating disease.
26519257 Studied the expression of CXCL8-CXCR1/2 pathway, its impact on cell proliferation and cytokine expression in human colorectal carcinoma HCT116 cells.
26503598 CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma
26469385 HIV-1 MA interacts with CXCR2 in primary hepatocytes
26364720 Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway.
26302999 The results showed that the expression of N-Ac-PGP receptors (CXCR1 and CXCR2) in CESCs was upregulated by N-Ac-PGP.
26297794 Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26287498 CXCR2 expression is enriched in human atherosclerotic coronary artery.
More...

AA Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVM      1 - 70
LVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACI     71 - 140
SVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRML    141 - 210
LRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQ    211 - 280
VIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG    281 - 350
SSSGHTSTTL                                                                351 - 360
//

Text Mined References (288)

PMID Year Title
26648969 The CXCR2 Gene Polymorphism Is Associated with Stroke in Patients with Essential Hypertension.
26559818 2015 Trefoil Factor-3 (TFF3) Stimulates De Novo Angiogenesis in Mammary Carcinoma both Directly and Indirectly via IL-8/CXCR2.
26521741 2015 Epigenetic regulation of interleukin-8, an inflammatory chemokine, in osteoarthritis.
26519257 2015 The role of interleukin-8 (CXCL8) and CXCR2 in acquired chemoresistance of human colorectal carcinoma cells HCT116.
26503598 2015 CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma.
26364720 2015 The lncRNA MALAT1 protects the endothelium against ox-LDL-induced dysfunction via upregulating the expression of the miR-22-3p target genes CXCR2 and AKT.
26302999 2015 Collagen-Derived N-Acetylated Proline-Glycine-Proline in Intervertebral Discs Modulates CXCR1/2 Expression and Activation in Cartilage Endplate Stem Cells to Induce Migration and Differentiation Toward a Pro-Inflammatory Phenotype.
26297794 2015 Serum amyloid A1? induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26287498 2015 CXCL5 is associated with the increased risk of coronary artery disease.
26267317 2015 The role of interleukin-8 (IL-8) and IL-8 receptors in platinum response in high grade serous ovarian carcinoma.
More...