Property Summary

Ligand Count 90
NCBI Gene PubMed Count 194
PubMed Score 278.12
PubTator Score 273.78

Knowledge Summary

Patent (40,133)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Colitis, Ulcerative 59 0.0 0.0
HIV Infections 102 0.0 0.0
Disease Target Count
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
lung carcinoma -2.000 1.1e-09
mucosa-associated lymphoid tissue lympho... 1.793 2.4e-02
non-small cell lung carcinoma -1.500 8.7e-17
osteosarcoma -1.148 3.8e-03
psoriasis 1.700 2.0e-04

 CSPA Cell Line (1)

Gene RIF (162)

AA Sequence

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVG      1 - 70
RSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIV     71 - 140
HATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFG    141 - 210
FIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERR    211 - 280
NNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL    281 - 350
//

Text Mined References (195)

PMID Year Title