Property Summary

NCBI Gene PubMed Count 186
Grant Count 102
R01 Count 71
Funding $9,756,293.79
PubMed Score 257.78
PubTator Score 273.78

Knowledge Summary

Patent (40,133)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma -1.148 0.004
lung carcinoma -2.000 0.000
non-small cell lung carcinoma -1.500 0.000
mucosa-associated lymphoid tissue lympho... 1.793 0.024

Synonym

Accession P25024 B2R6Q3 Q2YEF8 Q2YEG4 Q2YEG5 Q2YEG7 Q2YEG8 Q53R18 Q6IN95 Q8N6T6 Q9P2T8 Q9P2T9 Q9P2U0 Q9P2U1 Q9P2U2 CXC-R1
Symbols C-C
CD128
CD181
CKR-1
IL8R1
IL8RA
CMKAR1
IL8RBA
CDw128a
C-C-CKR-1

Gene

PDB

1ILP   1ILQ   2LNL  

  TechDev Info (1)

Gene RIF (156)

PMID Text
26791948 These data demonstrate a biological function for mouse Cxcr1 in vivo and indicate that CXCR1-dependent neutrophil effector function is a critical innate protective mechanism of fungal clearance and host survival in systemic candidiasis.
26617848 Evaluation of GPER1, EGFR and CXCR1 mRNA/protein expression may be helpful in differential diagnosis of malignant follicular thyroid carcinoma and benign follicular thyroid adenoma.
26316141 Report increased expression of CXCR1 in active pulmonary tuberculosis patients and decreased leukocyte oxidative capacity.
26302999 The results showed that the expression of N-Ac-PGP receptors (CXCR1 and CXCR2) in CESCs was upregulated by N-Ac-PGP.
26267317 Inhibition of IL-8 signalling can enhance response in platinum sensitive and resistant high grade serous ovarian carcinoma.
26087179 G31P blockage of CXCR1 and CXCR2 can inhibit human lung cancer cell growth and metastasis
26065367 In HCC cell lines, IL8 activates expression of FOXC1 via the phosphoinositide 3-kinase signaling to AKT and hypoxia-inducible factor 1alpha. FOXC1 expression leads to transactivation of CXCR1 and CCL2, promoting inflammation and invasivion/metastasis.
25426644 elevated IL-8 secretion and change in CXCR expression contribute toward elevated melanoma malignancy upon reattachment from cell suspension
25327289 The study characterized the binding of a human CXCR1 N-terminal domain peptide (hCXCR1Ndp) to WT CXCL8 under conditions where it exists as both monomers and dimers.
25200966 NTS/IL-8/CXCR1/STAT3 signaling is crucial for the maintenance of stem-like traits in glioblastoma stem cells .
More...

AA Sequence

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVG      1 - 70
RSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIV     71 - 140
HATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFG    141 - 210
FIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERR    211 - 280
NNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL    281 - 350
//

Text Mined References (187)

PMID Year Title
26791948 2016 CXCR1-mediated neutrophil degranulation and fungal killing promote Candida clearance and host survival.
26617848 2015 Role of GPER1, EGFR and CXCR1 in differentiating between malignant follicular thyroid carcinoma and benign follicular thyroid adenoma.
26316141 2015 Impaired CXCR1-dependent oxidative defence in active tuberculosis patients.
26302999 2015 Collagen-Derived N-Acetylated Proline-Glycine-Proline in Intervertebral Discs Modulates CXCR1/2 Expression and Activation in Cartilage Endplate Stem Cells to Induce Migration and Differentiation Toward a Pro-Inflammatory Phenotype.
26267317 2015 The role of interleukin-8 (IL-8) and IL-8 receptors in platinum response in high grade serous ovarian carcinoma.
26087179 2015 CXCR1/2 antagonism with CXCL8/Interleukin-8 analogue CXCL8(3-72)K11R/G31P restricts lung cancer growth by inhibiting tumor cell proliferation and suppressing angiogenesis.
26065367 2015 Interleukin-8 Induces Expression of FOXC1 to Promote Transactivation of CXCR1 and CCL2 in Hepatocellular Carcinoma Cell Lines and Formation of Metastases in Mice.
25426644 2015 Anchorage independency promoted tumor malignancy of melanoma cells under reattachment through elevated interleukin-8 and CXC chemokine receptor 1 expression.
25327289 2015 Solution NMR characterization of WT CXCL8 monomer and dimer binding to CXCR1 N-terminal domain.
25200966 2014 Neurotensin signaling regulates stem-like traits of glioblastoma stem cells through activation of IL-8/CXCR1/STAT3 pathway.
More...