Property Summary

NCBI Gene PubMed Count 241
Grant Count 340
R01 Count 209
Funding $57,155,483.89
PubMed Score 230.92
PubTator Score 130.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.427 0.001
astrocytoma 1.600 0.003
diabetes mellitus -1.300 0.002
acute myeloid leukemia 1.800 0.014

Synonym

Accession P24928 A6NN93 B9EH88 Q6NX41 RNA polymerase II subunit B1
Symbols RPB1
RPO2
POLR2
POLRA
RPBh1
RPOL2
RpIILS
hsRPB1
hRPB220

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   4JXT   3D9K   3D9L   3D9M   3D9N   3D9O   3D9P   2GHQ   2GHT   2LTO  

Gene RIF (156)

PMID Text
27058666 TOP1 bound at promoters was discovered to become fully active only after pause-release. This transition coupled the phosphorylation of the carboxyl-terminal-domain (CTD) of RNA polymerase II (RNAPII) with stimulation of TOP1 above its basal rate, enhancing its processivity.
26807597 Data suggest RNA polymerase II (POLR2A) is extensively modified on its unique C-terminal domain (CTD) by O-GlcNAc transferase (OGT); efficient O-GlcNAcylation requires a minimum of 20 heptad CTD repeats in POLR2A and more than half of NTD of OGT.
26515650 Serine phosphorylation stimulates whereas tyrosine phosphorylation inhibits the protein-binding activity of the RNA Pol II C-terminal domain.
26499373 The amount of RNA polymerase II (RNAPII) on the HIV promoter and other viral regions was strongly diminished in HIV-infected CD4+ cells co-cultivated with cell non-cytotoxic antiviral response-expressing CD8+ cells.
26488441 HIV Tat precisely controls RNA polymerase II recruitment and pause release to fine-tune the initiation and elongation steps in target genes.
26432391 Its variant is not related to sporadic PD in Chinese Han population.
25165108 This viral pre-initiation complex is composed of five different proteins in addition to Epstein-Barr virus BcRF1 and interacts with cellular RNA polymerase II
25023704 Ash2L acts in concert with P53 promoter occupancy to activate RNA Polymerase II by aiding formation of a stable transcription pre-initiation complex required for its activation.
24828331 Authors show that the NSs protein of Schmallenberg virus (SBV) induces the degradation of the RPB1 subunit of RNA polymerase II and consequently inhibits global cellular protein synthesis and the antiviral response.
24819879 Data show that E2F-1 form a complex with RNA polymerase II and protein PURA for transcriptional activation of the secondary promoter.
More...

AA Sequence

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGR      1 - 70
CQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKR     71 - 140
LTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ    141 - 210
EKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKL    211 - 280
ADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRV    281 - 350
RGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII    351 - 420
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTT    421 - 490
PYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV    491 - 560
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVV    561 - 630
ENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQ    631 - 700
DIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMV    701 - 770
VSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA    771 - 840
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLK    841 - 910
PSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLP    911 - 980
CNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLC    981 - 1050
SRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG   1051 - 1120
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQ   1121 - 1190
EWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR   1191 - 1260
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKA   1261 - 1330
LQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLAL   1331 - 1400
LCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGC   1401 - 1470
FDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMT   1471 - 1540
PGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTP   1541 - 1610
QSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP   1611 - 1680
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSP   1681 - 1750
TSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTP   1751 - 1820
SSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSP   1821 - 1890
TSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPA   1891 - 1960
ISPDDSDEEN                                                               1961 - 1970
//

Text Mined References (270)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
27058666 2016 RNA Polymerase II Regulates Topoisomerase 1 Activity to Favor Efficient Transcription.
26807597 2016 Distributive O-GlcNAcylation on the Highly Repetitive C-Terminal Domain of RNA Polymerase II.
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
26687004 2015 Methylation of RNA polymerase II non-consensus Lysine residues marks early transcription in mammalian cells.
26515650 2015 Proteomics studies of the interactome of RNA polymerase II C-terminal repeated domain.
26499373 2016 The CD8+ cell non-cytotoxic antiviral response affects RNA polymerase II-mediated human immunodeficiency virus transcription in infected CD4+ cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26488441 2015 HIV Tat controls RNA Polymerase II and the epigenetic landscape to transcriptionally reprogram target immune cells.
26432391 2015 TCEANC2 rs10788972 and rs12046178 variants in the PARK10 region in Chinese Han patients with sporadic Parkinson's disease.
More...