Property Summary

NCBI Gene PubMed Count 19
Grant Count 21
R01 Count 16
Funding $2,232,875.08
PubMed Score 28.58
PubTator Score 30.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
22397853 Tissue distribution of transgenic mRNA expression agrees well with the known respiratory tract-selective expression of CYP2A13 and CYP2F1 and hepatic expression of CYP2B6 in humans.
22232929 Patients with occupational chronic bronchitis and healthy workers significantly differed from each other in the frequency distribution of the genotypes ofthe CYP2F1 (rs11399890, c.14_15insC
20198857 Association analysis of CYP2F1 gene insertion variant with chronic obstructive pulmonary disease have shown high frequency (87.5%) of normal allele in Tatars patients with very severe stage and manifestation of chronic obstructive pulmonary disease.
20198857 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
17943660 Observational study of genotype prevalence. (HuGE Navigator)
17327131 Observational study of gene-disease association. (HuGE Navigator)
17327131 24 novel mutations distributed in the promoter region of the gene, as well as in the coding regions and their flanking intronic sequences;the CYP2F1 genetic polymorphism has no implications in the pathogenesis of lung cancer
16883522 A lot of genetic polymorphism of CYP2F1 gene is found in Guangdong population of China, however, no single genetic polymorphism associated with the individual susceptibility to nasopharyngeal carcinoma can be identified.
16883522 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDSISTAILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTKLSKEYGSMYTVHL      1 - 70
GPRRVVVLSGYQAVKEALVDQGEEFSGRGDYPAFFNFTKGNGIAFSSGDRWKVLRQFSIQILRNFGMGKR     71 - 140
SIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIRLINDNFQIMS    141 - 210
SPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPL    211 - 280
SHFHMDTLLMTTHNLLFGGTKTVSTTLHHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTD    281 - 350
AVIHEVQRFADIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFLDANQSF    351 - 420
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNLPRPFQLCLRP    421 - 490
R//

Text Mined References (22)

PMID Year Title
22397853 2012 Generation and characterization of a CYP2A13/2B6/2F1-transgenic mouse model.
22232929 2011 [Polymorphic markers of the CYP1B1 (4326C > G), CYP2F1 (c.14_15insC), CYP2J2 (-76G > T), and CYP2S1 (13106C > T and 13255A > G) genes and genetic predisposition to chronic respiratory diseases induced by smoking and occupational factors].
20198857 [The CYP1B1 and CYP2F1 genes polymorphisms frequency in three ethnic groups of Bashkortostan and chronic obstructive pulmonary disease patients].
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
17943660 2007 CYP2F1 genetic polymorphism: identification of interethnic variations.
17327131 2007 Molecular analysis of the CYP2F1 gene: identification of a frequent non-functional allelic variant.
16883522 2006 [Study on genetic polymorphisms of CYP2F1 gene in Guangdong population of China].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...