Property Summary

Ligand Count 1
NCBI Gene PubMed Count 298
PubMed Score 262.39
PubTator Score 298.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 2.003 4.6e-06
Breast cancer 1.300 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.500 4.2e-03
lung adenocarcinoma 1.600 3.3e-06
lung cancer 1.800 1.6e-04
non-small cell lung cancer 1.502 9.3e-19
osteosarcoma -2.050 2.5e-03
ovarian cancer 2.600 8.6e-08
psoriasis 1.300 2.3e-09

Protein-protein Interaction (1)

Gene RIF (230)

AA Sequence

MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCAD      1 - 70
PCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLL     71 - 140
QPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKL    141 - 210
HQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAE    211 - 280
LLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR    281 - 350
GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA              351 - 410
//

Text Mined References (303)

PMID Year Title