Property Summary

NCBI Gene PubMed Count 271
Grant Count 399
R01 Count 24
Funding $190,153,813.64
PubMed Score 239.16
PubTator Score 298.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 2.500 0.000
osteosarcoma -2.050 0.002
adrenocortical carcinoma 2.003 0.000
non-small cell lung cancer 1.502 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.004
lung cancer 1.800 0.000
lung adenocarcinoma 1.600 0.000
Breast cancer 1.400 0.000
ovarian cancer 2.600 0.000

Synonym

Accession P24864 A8K684 Q14091 Q8NFG1 Q92501 Q9UD21
Symbols CCNE
pCCNE1

Gene

PDB

1W98   5L2W  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (205)

PMID Text
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26647729 The effects of CCNE1 knockdown were dependent on the CCNE1 expression status.
26625764 The findings suggest that the role of cyclin E and tumor specific low molecular weight isoforms as mediators of tumorigenesis is in part dependent on p53 context.
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
26475304 Ad-cycE can target cyclin E overexpression in cancer cells and repress tumor growth in syngeneic mouse models.
26344002 Both fenhexamid and cyprodinil may increase cancer cell proliferation by stimulating the protein expressions of cyclin D1 and cyclin E.
26219338 our findings identify a novel mechanism of cyclin E-mediated Mcl-1 regulation in human cancer
26204491 ovary tumors with elevated CCNE1 expression may be staged for Cdk2-targeted therapy
26057453 miR-144-5p functions as tumour suppressor in BC cells. CCNE1 and CCNE2 were directly regulated by miR-144-5p and might be good prognostic markers for survival of bladder cancer patients
26026100 Contrary to previous literature, we found a correlation between cyclin E expression and prognosis. Further large-scale studies are required to confirm our findings.
More...

AA Sequence

MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCAD      1 - 70
PCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLL     71 - 140
QPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKL    141 - 210
HQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAE    211 - 280
LLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR    281 - 350
GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA              351 - 410
//

Text Mined References (276)

PMID Year Title
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26647729 2016 CCNE1 amplification is associated with aggressive potential in endometrioid endometrial carcinomas.
26625764 2015 Overexpression of Cyclin E and its Low Molecular Weight Isoforms Cooperate with Loss of p53 in Promoting Oncogenic Properties of MCF-7 Breast Cancer Cells.
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26475304 2015 Oncolytic adenovirus targeting cyclin E overexpression repressed tumor growth in syngeneic immunocompetent mice.
26344002 2015 Effect of fenhexamid and cyprodinil on the expression of cell cycle- and metastasis-related genes via an estrogen receptor-dependent pathway in cellular and xenografted ovarian cancer models.
26219338 2015 Cyclin E/Cdk2-dependent phosphorylation of Mcl-1 determines its stability and cellular sensitivity to BH3 mimetics.
26204491 2015 Cyclin-dependent kinase 2 is an ideal target for ovary tumors with elevated cyclin E1 expression.
26057453 2015 Tumour-suppressive microRNA-144-5p directly targets CCNE1/2 as potential prognostic markers in bladder cancer.
26026100 2015 Cyclin E Expression Correlates with Cancer-specific Survival in Endometrial Endometrioid Adenocarcinoma.
More...