Property Summary

Ligand Count 1
NCBI Gene PubMed Count 84
PubMed Score 369.43
PubTator Score 526.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (63)

AA Sequence

MRGMKLLGALLALAALLQGAVSLKIAAFNIQTFGETKMSNATLVSYIVQILSRYDIALVQEVRDSHLTAV      1 - 70
GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDTFNREPAIVRF     71 - 140
FSRFTEVREFAIVPLHAAPGDAVAEIDALYDVYLDVQEKWGLEDVMLMGDFNAGCSYVRPSQWSSIRLWT    141 - 210
SPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHYPVEVM    211 - 280
LK                                                                        281 - 282
//

Text Mined References (84)

PMID Year Title