Property Summary

NCBI Gene PubMed Count 18
PubMed Score 301.86
PubTator Score 62.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.600 7.3e-03
axial spondyloarthropathy 1.700 4.8e-02
Becker muscular dystrophy 1.145 8.8e-03
Breast cancer -1.900 1.4e-09
breast carcinoma -1.300 8.2e-05
colon cancer -1.300 1.8e-02
cystic fibrosis -1.370 5.8e-06
Duchenne muscular dystrophy 1.242 4.3e-06
ductal carcinoma in situ -1.600 4.7e-04
glioblastoma 1.600 7.4e-03
intraductal papillary-mucinous adenoma (... -2.100 3.7e-04
intraductal papillary-mucinous carcinoma... -2.100 5.2e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.2e-02
invasive ductal carcinoma -2.000 6.5e-04
limb girdle muscular dystrophy 2B 1.082 7.4e-04
lung adenocarcinoma -1.200 1.4e-16
lung cancer -1.700 1.6e-03
lung carcinoma -1.400 2.6e-18
malignant mesothelioma -1.100 1.0e-05
non-small cell lung cancer -1.394 1.6e-10
ovarian cancer -2.500 9.0e-09
pancreatic cancer 1.200 2.4e-02
primary pancreatic ductal adenocarcinoma 3.309 2.5e-04
psoriasis -1.800 3.7e-04
subependymal giant cell astrocytoma 3.266 1.3e-02

Gene RIF (12)

AA Sequence

MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYL      1 - 70
EGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVD     71 - 140
EMYREAPIDKKGNFNYVEFTRILKHGAKDKDD                                          141 - 172
//

Text Mined References (23)

PMID Year Title