Property Summary

NCBI Gene PubMed Count 16
PubMed Score 299.44
PubTator Score 62.34

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Brain edema 26
Vascular Diseases 16
Disease Target Count P-value
lung carcinoma 2844 2.56686466769899E-18
breast carcinoma 1614 1.68287825199777E-11
non-small cell lung cancer 2798 1.55223631362263E-10
lung adenocarcinoma 2714 1.3815057221063E-9
Breast cancer 3099 1.41172364632258E-9
ovarian cancer 8492 5.89424585435517E-7
Duchenne muscular dystrophy 602 4.2957984177672E-6
colon cancer 1475 4.94841228379791E-6
malignant mesothelioma 3163 1.0170975204417E-5
lung cancer 4473 4.50519468592843E-5
cystic fibrosis 1670 5.42588005277113E-5
pancreatic cancer 2300 1.21930428008815E-4
primary pancreatic ductal adenocarcinoma 1271 2.51943508134199E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.66837396216239E-4
psoriasis 6685 3.70895707522786E-4
ductal carcinoma in situ 1745 4.65650222884387E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.19355951311704E-4
invasive ductal carcinoma 2950 6.49167607203365E-4
limb girdle muscular dystrophy 2B 74 7.44244787073774E-4
atypical teratoid / rhabdoid tumor 4369 0.00734983075464858
glioblastoma 5572 0.00738793467839445
Becker muscular dystrophy 187 0.00882414014089164
subependymal giant cell astrocytoma 2287 0.0129520002666702
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0316527216861295
axial spondyloarthropathy 28 0.0481788102207522



Accession P24844 E1P5T6 Q9BQL9 Q9BUF9 Q9H136
Symbols LC20


  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (10)

25179839 These findings suggested that low MYLK and MYL9 expressions might be associated with the development of NSCLC.
24338276 the decreased expression of MYL9 may play an important role in tumor progression of prostate cancer
24189459 Overexpression of SMYD3 promotes MRTF-A-mediated upregulation of MYL9 and migration of MCF-7 breast cancer cells
24084383 Overexpression of MRTF-A significantly promoted the migration of MCF-7 cells through its transactivation effects on MYL9 and CYR61 genes
23538510 surface CD3 expression proceeds through both MYL9-dependent and MYL9-independent pathways (i.e. the protein kinase C- dependent pathway) in Jurkat cells.
21251247 Endogenous Nogo-B, which may exert its effects through ARPC 2/3 and MYL-9, is necessary for the migration and contraction of airway smooth muscle cells.
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
19724058 use of a shRNA to decrease MYL9 expression showed that MYL9 was involved in proplatelet formation
18480596 Smooth muscle type isoform, MLC-2C, is the inducible isoform, and might play a crucial role in monocyte/macrophage cell lineage.
16076902 The FHC-mediated structural perturbations in RLC that affect Ca(2+) binding properties of mutated myocardium are responsible for triggering the abnormal function of the heart that in turn might initiate a hypertrophic process and lead to heart failure.

AA Sequence

EMYREAPIDKKGNFNYVEFTRILKHGAKDKDD                                          141 - 172

Text Mined References (21)

PMID Year Title
25179839 2014 MYLK and MYL9 expression in non-small cell lung cancer identified by bioinformatics analysis of public expression data.
24338276 2014 Decreased expression of myosin light chain MYL9 in stroma predicts malignant progression and poor biochemical recurrence-free survival in prostate cancer.
24189459 2014 Histone methyltransferase SMYD3 promotes MRTF-A-mediated transactivation of MYL9 and migration of MCF-7 breast cancer cells.
24084383 2013 Myocardin-related transcription factor A is up-regulated by 17?-estradiol and promotes migration of MCF-7 breast cancer cells via transactivation of MYL9 and CYR61.
23538510 2012 Surface CD3 expression proceeds through both myosin regulatory light chain 9 (MYL9)-dependent and MYL9-independent pathways in Jurkat cells.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
21457715 2011 Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.
21408167 2011 New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.
21251247 2011 Nogo-B regulates migration and contraction of airway smooth muscle cells by decreasing ARPC 2/3 and increasing MYL-9 expression.
21072057 2011 Caspase-activated ROCK-1 allows erythroblast terminal maturation independently of cytokine-induced Rho signaling.