Property Summary

NCBI Gene PubMed Count 215
PubMed Score 216.54
PubTator Score 998.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.1
Vascular disease 319 0.0 2.5
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (34)

Disease log2 FC p
Breast cancer -1.800 4.2e-16
Endometriosis 1.280 2.2e-02
acute quadriplegic myopathy 1.083 3.4e-02
adult high grade glioma 2.800 1.6e-04
astrocytic glioma 3.100 2.0e-03
Astrocytoma, Pilocytic 2.100 3.4e-04
Atopic dermatitis 1.400 3.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.366 2.0e-02
Becker muscular dystrophy 1.520 7.8e-03
colon cancer -2.000 7.8e-03
cystic fibrosis 1.068 2.5e-05
Duchenne muscular dystrophy 1.564 2.4e-06
ductal carcinoma in situ 1.700 1.0e-02
ependymoma 4.100 1.8e-02
glioblastoma 2.400 1.5e-05
group 4 medulloblastoma -1.700 1.1e-02
interstitial cystitis 1.600 3.7e-02
interstitial lung disease 1.300 1.7e-02
intraductal papillary-mucinous adenoma (... -1.400 4.9e-02
juvenile dermatomyositis 1.609 9.1e-08
limb girdle muscular dystrophy 2B 1.161 1.9e-03
lung adenocarcinoma 1.900 2.6e-04
lung cancer 3.000 5.0e-05
lung carcinoma -1.300 1.2e-06
malignant mesothelioma -6.100 8.2e-10
non diabetic and post-ischemic heart fai... -2.100 3.1e-02
non primary Sjogren syndrome sicca -1.300 1.6e-02
non-small cell lung cancer 1.969 3.2e-11
oligodendroglioma 2.300 7.2e-03
osteosarcoma -2.265 1.6e-03
ovarian cancer 1.900 9.8e-03
subependymal giant cell astrocytoma 2.705 2.8e-02
ulcerative colitis 4.500 1.4e-06
uncontrolled asthma 1.300 1.9e-02

 GO Function (1)

Gene RIF (184)

AA Sequence

MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLES      1 - 70
ASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQC     71 - 140
TAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDG    141 - 210
FTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCN    211 - 280
KPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHAC    281 - 350
HTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN    351 - 420
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDG    421 - 490
YTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKE    491 - 560
QRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLV    561 - 630
VTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKK    631 - 700
SIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQ    701 - 770
TGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK    771 - 840
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSIT    841 - 910
LEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATIN    911 - 980
AATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYSLPTGQWVGVQLPRNTTSYVLRGLEPGQEYN    981 - 1050
VLLTAEKGRHKSKPARVKASTEQAPELENLTVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNL   1051 - 1120
TVPGSLRAVDIPGLKAATPYTVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEG   1121 - 1190
AYEYFFIQVQEADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG   1191 - 1260
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGTPYTVTLHGEV   1261 - 1330
RGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQVQEVNKVEAAQNLTLPGSLR   1331 - 1400
AVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPEIGNLNVSDITPESFNLSWMATDGIFETFTI   1401 - 1470
EIIDSNRLLETVEYNISGAERTAHISGLPPSTDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDI   1471 - 1540
NPYGFTVSWMASENAFDSFLVTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKP   1541 - 1610
LRAEIVTEAEPEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL   1611 - 1680
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESFRITYVPITGG   1681 - 1750
TPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQ   1751 - 1820
PAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSP   1821 - 1890
RDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNG   1891 - 1960
PLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRK   1961 - 2030
NGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK   2031 - 2100
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWF   2101 - 2170
HWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA                                          2171 - 2201
//

Text Mined References (222)

PMID Year Title