Property Summary

NCBI Gene PubMed Count 198
Grant Count 412
R01 Count 175
Funding $72,414,978.9
PubMed Score 2227.43
PubTator Score 998.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Expression

Synonym

Accession P24821 C9IYT7 C9J575 C9J6D9 C9J848 Q14583 Q15567 Q5T7S3 TN
Symbols GP
JI
TN
HXB
GMEM
TN-C
DFNA56
150-225

Gene

TNC

PANTHER Protein Class (1)

PDB

1TEN   2RB8   2RBL  

 GO Function (1)

Gene RIF (172)

PMID Text
26731558 Tenascin-C overexpression in cancer cells and stromal fibroblasts was an independent poor prognostic factor for overall survival and disease-free survival esophageal squamous cell carcinoma patients.
26652622 Co-expression of Matrix metalloproteinase-9 and Tenascin-C was associated with poorer prognosis and was found to be an independent predictor of survival
25808872 A pivotal role for TNC in tuning the local immune response to establish equilibrium between disseminated nodal cancer stem cells and the immune system.
25794567 No difference in tenascin-C expression was found in COPD.
25774061 Serum TNC levels are significantly raised and correlate with various clinical and laboratory variables of disease activity in children with enthesitis-related arthritis
25646025 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway.
25609695 lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival
25567561 prepartum and postpartum TN-C serum levels significantly higher in mild and severe preeclampsia than in healthy pregnancy
25515583 the fibronectin type III-like repeats in tenascin-C may be playing an important role in PCO.
25469866 Studied the expression of TNC in tissue microarrays including 17 GBMs, 18 WHO grade III astrocytomas, 15 WHO grade II astrocytomas, 4 WHO grade I astrocytomas, and 7 normal brain tissue samples by immunohistochemical staining.
More...

AA Sequence

MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLES      1 - 70
ASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQC     71 - 140
TAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDG    141 - 210
FTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCN    211 - 280
KPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHAC    281 - 350
HTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN    351 - 420
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDG    421 - 490
YTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKE    491 - 560
QRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLV    561 - 630
VTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKK    631 - 700
SIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQ    701 - 770
TGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK    771 - 840
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSIT    841 - 910
LEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATIN    911 - 980
AATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYSLPTGQWVGVQLPRNTTSYVLRGLEPGQEYN    981 - 1050
VLLTAEKGRHKSKPARVKASTEQAPELENLTVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNL   1051 - 1120
TVPGSLRAVDIPGLKAATPYTVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEG   1121 - 1190
AYEYFFIQVQEADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG   1191 - 1260
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGTPYTVTLHGEV   1261 - 1330
RGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQVQEVNKVEAAQNLTLPGSLR   1331 - 1400
AVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPEIGNLNVSDITPESFNLSWMATDGIFETFTI   1401 - 1470
EIIDSNRLLETVEYNISGAERTAHISGLPPSTDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDI   1471 - 1540
NPYGFTVSWMASENAFDSFLVTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKP   1541 - 1610
LRAEIVTEAEPEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL   1611 - 1680
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESFRITYVPITGG   1681 - 1750
TPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQ   1751 - 1820
PAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSP   1821 - 1890
RDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNG   1891 - 1960
PLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRK   1961 - 2030
NGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK   2031 - 2100
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWF   2101 - 2170
HWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA                                          2171 - 2201
//

Text Mined References (204)

PMID Year Title
26731558 2016 Tenascin-C, a Prognostic Determinant of Esophageal Squamous Cell Carcinoma.
26652622 2015 The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25808872 2015 Tenascin-C Protects Cancer Stem-like Cells from Immune Surveillance by Arresting T-cell Activation.
25794567 2015 Gene and Protein Expression of Fibronectin and Tenascin-C in Lung Samples from COPD Patients.
25774061 2015 Tenascin-C Levels, A Toll-like Receptor 4 Ligand, in Enthesitis-related Arthritis Category of Juvenile Idiopathic Arthritis: A Cross-sectional and Longitudinal Study.
25646025 2015 ADAM-9 is a novel mediator of tenascin-C-stimulated invasiveness of brain tumor-initiating cells.
25609695 2015 Global Oct4 target gene analysis reveals novel downstream PTEN and TNC genes required for drug-resistance and metastasis in lung cancer.
25567561 2016 Tenascin C levels in patients with mild and severe preeclampsia.
25515583 2014 Targeting the fibronectin type III repeats in tenascin-C inhibits epithelial-mesenchymal transition in the context of posterior capsular opacification.
More...