Property Summary

NCBI Gene PubMed Count 72
Grant Count 152
R01 Count 105
Funding $18,236,049.51
PubMed Score 67.41
PubTator Score 233.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24752 B2R6H1 G3XAB4 Q96FG8
Symbols T2
MAT
ACAT
THIL

Gene

PANTHER Protein Class (2)

PDB

2F2S   2IB7   2IB8   2IB9   2IBU   2IBW   2IBY  

Gene RIF (50)

PMID Text
27264805 compound heterozygous of ACAT1 gene mutations probably underlie the beta-ketothiolase deficiency in our patient
26252415 ACAT1 regulates glioblastoma-cell proliferation via modification of the Akt and/or the ERK1/2 pathway.
25639359 Data indicate that acetyl-CoA acetyltransferase (ACAT1) and malate dehydrogenase (MDH2) are involved in various drug-resistance-forming mechanisms.
25339759 Acat1 gene knock-out increases phagocytic uptake of amyloid beta-protein (1-42).
25099943 ACAT1, ACACA, ALDH6A1 and MTHFD1 represent novel biomarkers in adipose tissue associated with type 2 diabetes in obese individuals.
24577316 Data show that the C allele of acyl-CoA acyltransferase-1 (ACAT-1) rs1044925 was associated with a decreased risk of coronary artery disease and ischemic stroke patients.
24517390 the enzyme activity of ACAT1 with Gln526 is less active than that of ACAT1 with Arg526 by 40%; Pro347 located near transmembrane domain 5 plays an important role in modulating enzyme catalysis
24486017 the pyruvate dehydrogenase complex is regulated by Tyr phosphorylation of PDP1, which toggles recruitment between ACAT1 and SIRT3
24407243 Induction of apoptosis and necroptosis by 24(S)-hydroxycholesterol is dependent on activity ACAT1.
24311408 these findings indicate that ACAT1 expression could serve as a potential prognostic marker in prostate cancer, specifically in differentiating indolent and aggressive forms of cancer.
More...

AA Sequence

MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSI      1 - 70
AIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSL     71 - 140
MCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNE    141 - 210
QDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTA    211 - 280
ANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMW    281 - 350
EVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS    351 - 420
AMLIQKL                                                                   421 - 427
//

Text Mined References (80)

PMID Year Title
27264805 2016 [Analysis of clinical phenotype and ACAT1 gene mutation in a family affected with beta-ketothiolase deficiency].
26252415 2015 K604, a specific acyl?CoA:cholesterol acyltransferase 1 inhibitor, suppresses proliferation of U251?MG glioblastoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25639359 2015 Mitochondrial proteomics with siRNA knockdown to reveal ACAT1 and MDH2 in the development of doxorubicin-resistant uterine cancer.
25339759 2014 Inhibiting ACAT1/SOAT1 in microglia stimulates autophagy-mediated lysosomal proteolysis and increases A?1-42 clearance.
25099943 2014 Downregulation of the acetyl-CoA metabolic network in adipose tissue of obese diabetic individuals and recovery after weight loss.
24577316 2014 Association between single nucleotide polymorphism rs1044925 and the risk of coronary artery disease and ischemic stroke.
24517390 2014 Acyl-coenzyme A:cholesterol acyltransferase 1 - significance of single-nucleotide polymorphism at residue 526 and the role of Pro347 near the fifth transmembrane domain.
24486017 2014 Tyr phosphorylation of PDP1 toggles recruitment between ACAT1 and SIRT3 to regulate the pyruvate dehydrogenase complex.
24407243 2014 Induction of apoptosis and necroptosis by 24(S)-hydroxycholesterol is dependent on activity of acyl-CoA:cholesterol acyltransferase 1.
More...