Property Summary

Ligand Count 12
NCBI Gene PubMed Count 77
PubMed Score 70.38
PubTator Score 233.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -2.027 5.2e-03
adrenocortical carcinoma -1.036 3.4e-04
colon cancer -1.300 4.8e-04
ductal carcinoma in situ -1.600 1.3e-03
fibroadenoma -1.100 4.7e-02
gastric carcinoma -1.200 2.9e-02
intraductal papillary-mucinous adenoma (... -1.100 1.7e-02
intraductal papillary-mucinous carcinoma... -1.700 2.6e-02
intraductal papillary-mucinous neoplasm ... -1.900 8.0e-03
invasive ductal carcinoma -1.600 4.3e-03
lung adenocarcinoma -1.100 3.3e-06
Multiple myeloma 1.609 5.8e-05
nephrosclerosis -1.194 3.3e-03
ovarian cancer -1.900 1.7e-05
pancreatic cancer -1.200 2.7e-05
pancreatic ductal adenocarcinoma liver m... -3.362 4.1e-03
Waldenstrons macroglobulinemia 1.231 8.8e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (55)

AA Sequence

MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSI      1 - 70
AIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSL     71 - 140
MCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNE    141 - 210
QDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTA    211 - 280
ANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMW    281 - 350
EVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS    351 - 420
AMLIQKL                                                                   421 - 427
//

Text Mined References (85)

PMID Year Title