Property Summary

NCBI Gene PubMed Count 77
PubMed Score 70.38
PubTator Score 233.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -2.027 5.2e-03
adrenocortical carcinoma -1.036 3.4e-04
colon cancer -1.300 4.8e-04
ductal carcinoma in situ -1.600 1.3e-03
fibroadenoma -1.100 4.7e-02
gastric carcinoma -1.200 2.9e-02
intraductal papillary-mucinous adenoma (... -1.100 1.7e-02
intraductal papillary-mucinous carcinoma... -1.700 2.6e-02
intraductal papillary-mucinous neoplasm ... -1.900 8.0e-03
invasive ductal carcinoma -1.600 4.3e-03
lung adenocarcinoma -1.100 3.3e-06
Multiple myeloma 1.609 5.8e-05
nephrosclerosis -1.194 3.3e-03
ovarian cancer -1.900 1.7e-05
pancreatic cancer -1.200 2.7e-05
pancreatic ductal adenocarcinoma liver m... -3.362 4.1e-03
Waldenstrons macroglobulinemia 1.231 8.8e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (55)

AA Sequence

MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSI      1 - 70
AIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSL     71 - 140
MCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNE    141 - 210
QDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTA    211 - 280
ANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMW    281 - 350
EVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS    351 - 420
AMLIQKL                                                                   421 - 427
//

Text Mined References (85)

PMID Year Title