Property Summary

NCBI Gene PubMed Count 89
Grant Count 1
Funding $103,826.67
PubMed Score 60.05
PubTator Score 61.03

Knowledge Summary

Patent (5,659)

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.052 0.000
malignant mesothelioma -3.100 0.000
esophageal adenocarcinoma -1.400 0.044
psoriasis 1.400 0.001
osteosarcoma -1.440 0.006
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.012
lung cancer -3.400 0.000
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.700 0.000
ulcerative colitis 1.200 0.000
pituitary cancer -2.000 0.000

Synonym

Accession P24723 B4DJN5 Q16246 Q8NE03
Symbols PKCL
PKC-L
PRKCL
nPKC-eta

Gene

 Grant Application (1)

PDB

2FK9   3TXO  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (89)

PMID Text
25412309 PKCeta promotes senescence through its ability to upregulate the expression of the cell cycle inhibitors p21Cip1 and p27Kip1 and enhance transcription and secretion of IL-6.
25370935 variant genotypes of PRKCH 1425G/A are an independent prognostic factor for ischemic stroke in the final multivariate Cox regression model
25272991 Meta-analysis indicated that the 1425G/A SNP in PRKCH may contribute to susceptibility of stroke, especially for ischemic stroke.
24788043 PKC-eta associates with NHE3 and gamma tubulin to promote the cell polarity during migration.
24784886 These results suggest that siRNA-mediated silencing of PKCeta can be a potent tool to complement existing chemotherapy regimens for treating EBV(+) B lymphoma.
24534126 The 1425G/A polymorphism in PRKCH is not a significant predictor of stroke recurrence in patients with acute ischemic stroke during a 2-year follow-up period.
23868949 the PKC family genes may play a role in the pathogenesis of MS relapse through modulating the association between 25(OH)D and relapse.
23562764 Upregulation of PKCeta contributes to breast cancer cell growth and targeting either PKCepsilon or PDK1 triggers PKCeta downregulation
22999931 Protein kinase Ceta 1425G/A variant was not a risk locus for deep intracerebral hemorrhage phenotype.
22892130 these results suggest that the regulation of PKCeta is unique and PKCepsilon is required for the PKC activator-induced upregulation of PKCeta.
More...

AA Sequence

MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNE      1 - 70
EFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSF     71 - 140
TEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVV    141 - 210
HKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICK    211 - 280
MNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRL    281 - 350
GIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF    351 - 420
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDLKLDNVLLDHE    421 - 490
GHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENED    491 - 560
DLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHAILRHPFFKEIDWAQLNHRQIEPP    561 - 630
FRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP                     631 - 683
//

Text Mined References (99)

PMID Year Title
25412309 2014 PKC? promotes senescence induced by oxidative stress and chemotherapy.
25370935 2015 PRKCH 1425G/A Polymorphism Predicts Recurrence of Ischemic Stroke in a Chinese Population.
25272991 2014 A quantitative assessment of the association between 1425G/A polymorphism in PRKCH and risk of stroke.
24788043 2014 NHE3 phosphorylation via PKC? marks the polarity and orientation of directionally migrating cells.
24784886 2014 Silencing of PKC? induces cycle arrest of EBV(+) B lymphoma cells by upregulating expression of p38-MAPK/TAp73/GADD45? and increases susceptibility to chemotherapeutic agents.
24534126 2014 Impact of the 1425G/A polymorphism of PRKCH on the recurrence of ischemic stroke: Fukuoka Stroke Registry.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23868949 2014 Novel modulating effects of PKC family genes on the relationship between serum vitamin D and relapse in multiple sclerosis.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
More...