Property Summary

NCBI Gene PubMed Count 110
Grant Count 22
R01 Count 15
Funding $2,020,934.88
PubMed Score 282.00
PubTator Score 247.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.528 0.001
osteosarcoma 1.372 0.002
non-small cell lung cancer 1.388 0.000
lung cancer 2.200 0.000
group 3 medulloblastoma 1.600 0.007
non primary Sjogren syndrome sicca 1.100 0.020
Alzheimer's disease -1.200 0.017
Pick disease -1.100 0.000
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.700 0.000
ovarian cancer 1.600 0.000

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
652005 confirmatory 73 / 0 / 265 Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay
686963 confirmatory 4 / 0 / 13 SAR confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay
743308 confirmatory 17 / 0 / 26 SAR confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay, set 2

Gene RIF (92)

PMID Text
26386860 Suggest that hypermethylation of ACP1, BMP4, and TSPYL5 are common events in HCC and could be used as potentially detectable biomarkers in HCC tissues.
26216523 ADA6, PTPN22 and ACP1 are involved in immune reactions: since endometriosis has an autoimmune component.
26213100 LMPTP expression increases in end-stage heart failure in humans
25846885 Association of an increased risk of coronary artery disease, especially in females, with ACP1 polymorphisms.
25781955 ACP1 knockdown attenuates effects of osmotic stress in HaCaT cells, mainly in the status of Src kinase, Rac and STAT5 phosphorylation and activity.
25125338 ACP1 polymorphism is associated with type 1 diabetes mellitus.
25123136 The rs3828329 of ACP1 gene is also a risk factor of CAD in Han Chinese females aged 65 years and older.
24933463 the present study found that the ACP1*C allele, previously associated with an increased vulnerability to infectious/parasitic diseases may also be able to shape behavioral immune defenses by interaction with the level of E.
23959645 In Class 3 people the combination of high ACP f-isozyme concentration and the ADA*2 allele, lowers the rate of glycolysis that may reduce the amount of metabolic calories and activates Sirtuin genes that protect cells against age-related diseases.
23645747 mRNA expression of the slow isoform was increased in breast cancer and that of the fast isoform was reduced in breast cancer.
More...

AA Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP      1 - 70
MSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE     71 - 140
TVYQQCVRCCRAFLEKAH                                                        141 - 158
//

Text Mined References (115)

PMID Year Title
26386860 2016 Hypermethylation of ACP1, BMP4, and TSPYL5 in Hepatocellular Carcinoma and Their Potential Clinical Significance.
26216523 2016 The effect of ACP1, ADA6 and PTPN22 genetic polymorphisms on the association between p53 codon 72 polymorphism and endometriosis.
26213100 2015 Deletion of low molecular weight protein tyrosine phosphatase (Acp1) protects against stress-induced cardiomyopathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25846885 2015 Association of ACP1 gene polymorphisms and coronary artery disease in northeast Chinese population.
25781955 2015 Activation of the low molecular weight protein tyrosine phosphatase in keratinocytes exposed to hyperosmotic stress.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25125338 2014 Type 1 diabetes mellitus. Comparison between the association with PTPN22 genotype and the association with ACP1-ADA1 joint genotype.
25123136 2014 Association between phosphatase related gene variants and coronary artery disease: case-control study and meta-analysis.
24933463 2014 Interaction between infectious diseases and personality traits: ACP1*C as a potential mediator.
More...