Property Summary

NCBI Gene PubMed Count 142
Grant Count 113
R01 Count 83
Funding $6,152,065.93
PubMed Score 346.58
PubTator Score 241.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24593 Q5U0A3 IBP-5
Symbols IBP5

Gene

PDB

1BOE   1H59  

Gene RIF (106)

PMID Text
26103640 data provide further insights into the role of cellular compartmentalization in IGFBP-5-induced fibrosis
26010068 Results shed light on the mechanism of IGFBP5 as a potential tumor-suppressor in melanoma progression.
25827480 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25603050 miR-204-5p suppresses IGFBP5 expression by direct binding to the 3' untranslated region.
25548030 Our results suggest that rs6214 on the IGF1 gene and rs2854744 near the IGFBP3 gene potentially play an important role with ASMI in Taiwanese older adults in a metropolitan area.
25475528 Data indicate co-localization of insulin-like growth factor binding proteins IGFBP-4, IGFBP-5 in the syncytiotrophoblast layer of first trimester placental villi as early as 5 weeks of gestational age.
25422220 IGFBP5 mRNA expression is a good indicator in clinical outcome of breast cancer patients.
25248036 rs4442975 at 2q35 flanks a transcriptional enhancer that physically interacts with the promoter of IGFBP5. Evidence suggests that the g-allele confers increased breast cancer susceptibility through relative downregulation of IGFBP5.
25007054 IGFBP-5 may be a negative modulator of RASSF1C/ PIWIL1 growth-promoting activities.
24551065 IGFBP-5 induces its pro-fibrotic effects, at least in part, via DOK5. IGFBP-5 and DOK5 are both increased in systemic sclerosis fibroblasts and tissues and may thus be acting in concert to promote fibrosis.
More...

AA Sequence

MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVY      1 - 70
TERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPK     71 - 140
HTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV    141 - 210
PRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE            211 - 272
//

Text Mined References (144)

PMID Year Title
26103640 2015 IGFBP-5 Promotes Fibrosis Independently of Its Translocation to the Nucleus and Its Interaction with Nucleolin and IGF.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26010068 2015 Insulin-like growth factor binding protein 5 (IGFBP5) functions as a tumor suppressor in human melanoma cells.
25827480 2015 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25603050 2015 MiR-204-5p suppresses cell proliferation by inhibiting IGFBP5 in papillary thyroid carcinoma.
25548030 2015 Insulinlike Growth Factor-1 and Its Binding Protein-3 Polymorphisms Predict Circulating IGF-1 Level and Appendicular Skeletal Muscle Mass in Chinese Elderly.
25475528 2014 IGFBP-4 and -5 are expressed in first-trimester villi and differentially regulate the migration of HTR-8/SVneo cells.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25422220 2014 Detection of PIK3CA gene mutations with HRM analysis and association with IGFBP-5 expression levels in breast cancer.
25248036 2014 Evidence that breast cancer risk at the 2q35 locus is mediated through IGFBP5 regulation.
More...