Property Summary

Ligand Count 8
NCBI Gene PubMed Count 150
PubMed Score 351.84
PubTator Score 241.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.7
Disease Target Count Z-score Confidence
Cancer 2499 3.93 2.0

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 2.708 8.2e-03
adrenocortical carcinoma -1.883 6.4e-11
adult high grade glioma 2.000 1.4e-03
Amyotrophic lateral sclerosis -1.699 5.0e-05
astrocytoma 2.900 3.6e-02
Astrocytoma, Pilocytic 2.000 4.3e-07
Atopic dermatitis -1.600 9.6e-05
atypical teratoid / rhabdoid tumor 1.400 1.6e-05
autosomal dominant Emery-Dreifuss muscul... -1.812 7.3e-03
Becker muscular dystrophy -1.207 4.2e-02
cystic fibrosis 2.401 2.3e-06
dermatomyositis -1.700 1.6e-03
Down syndrome 1.400 1.6e-03
ductal carcinoma in situ -1.400 1.6e-03
ependymoma 1.700 1.9e-02
glioblastoma 2.100 7.2e-06
interstitial cystitis 1.300 7.8e-03
interstitial lung disease 1.200 3.4e-02
intraductal papillary-mucinous carcinoma... -1.900 3.3e-02
invasive ductal carcinoma -1.300 1.1e-02
limb girdle muscular dystrophy 2I -1.181 1.6e-02
malignant mesothelioma -2.900 1.4e-08
medulloblastoma 1.600 9.4e-03
medulloblastoma, large-cell 1.100 3.0e-02
mucosa-associated lymphoid tissue lympho... 1.568 1.3e-02
nephrosclerosis 1.229 1.6e-03
non-small cell lung cancer 1.268 5.6e-08
osteosarcoma -1.575 8.1e-03
ovarian cancer -1.900 3.3e-08
pancreatic cancer 1.100 2.5e-03
pituitary cancer -1.400 1.3e-04
primary pancreatic ductal adenocarcinoma 2.461 2.8e-03
primitive neuroectodermal tumor 1.400 6.9e-03
psoriasis -1.300 7.6e-04
ulcerative colitis 1.306 4.9e-02

 GWAS Trait (1)

Gene RIF (113)

AA Sequence

MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVY      1 - 70
TERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPK     71 - 140
HTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV    141 - 210
PRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE            211 - 272
//

Text Mined References (152)

PMID Year Title