Property Summary

Ligand Count 2
NCBI Gene PubMed Count 67
PubMed Score 126.12
PubTator Score 105.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.495 3.4e-02
adrenocortical carcinoma -3.083 7.1e-16
Breast cancer -1.400 4.4e-13
breast carcinoma -2.200 3.2e-06
colon cancer -1.100 7.1e-04
cystic fibrosis 1.100 2.8e-03
ductal carcinoma in situ -2.700 8.3e-04
ependymoma -1.600 2.0e-02
fibroadenoma -1.800 2.4e-03
intraductal papillary-mucinous adenoma (... -2.200 2.5e-04
intraductal papillary-mucinous carcinoma... -2.800 2.5e-05
intraductal papillary-mucinous neoplasm ... -1.900 9.7e-03
invasive ductal carcinoma -1.941 1.4e-03
lung adenocarcinoma -1.700 3.3e-06
malignant mesothelioma -4.200 3.6e-09
medulloblastoma, large-cell -1.300 3.7e-03
non-small cell lung cancer -1.158 1.6e-06
oligodendroglioma -1.500 1.4e-02
ovarian cancer -4.600 9.8e-16
pancreatic cancer 1.500 4.4e-03
pituitary cancer -3.100 3.0e-08
psoriasis -1.600 8.5e-05
sarcoidosis -1.300 2.9e-02
spina bifida -1.186 4.5e-02

Gene RIF (46)

AA Sequence

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE      1 - 70
CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN     71 - 140
PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG    141 - 210
PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG                                            211 - 240
//

Text Mined References (68)

PMID Year Title