Property Summary

NCBI Gene PubMed Count 66
Grant Count 10
R01 Count 10
Funding $581,716.08
PubMed Score 118.38
PubTator Score 105.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
ependymoma -1.600 0.020
oligodendroglioma -1.500 0.014
psoriasis -1.600 0.000
medulloblastoma, large-cell -1.300 0.004
adrenocortical adenoma -1.495 0.034
adrenocortical carcinoma -3.083 0.000
non-small cell lung cancer -1.158 0.000
intraductal papillary-mucinous adenoma (... -2.200 0.000
intraductal papillary-mucinous carcinoma... -2.800 0.000
intraductal papillary-mucinous neoplasm ... -1.900 0.010
colon cancer -1.100 0.001
sarcoidosis -1.300 0.029
breast carcinoma -2.400 0.000
fibroadenoma -1.800 0.002
cystic fibrosis 1.100 0.003
lung adenocarcinoma -1.700 0.000
invasive ductal carcinoma -3.900 0.000
non-inflammatory breast cancer -2.100 0.000
spina bifida -1.186 0.045
ductal carcinoma in situ -2.700 0.001
ovarian cancer -4.600 0.000
pituitary cancer -3.100 0.000
pancreatic cancer 1.500 0.004

Gene RIF (44)

PMID Text
26039376 We found that IGFBP6 and SATB2 were significantly down-regulated in HIV-infected CEM*174 cells and 3 different cohorts of HIV/AIDS patients while their promoters were predominantly hyper-methylated compared with normal controls.
24747338 CCL-18 and IGFBP-6 were identified as new potential serum biomarkers for prostate cancer.
24379119 IGFBP6 attenuation in ACTH-secreting pituitary adenomas is associated with tumor growth, through activation of PI3K-AKT-mTOR pathway
24182837 Our results indicate that IGF2 and IGFBP6 appear to govern various regulatory feedback mechanisms in periodontal ligament cells
24003225 Data indicate that IGFBP-6 binds to prohibitin-2 on the cell membrane, and knockdown of the latter abrogates IGFBP-6-induced migration.
23808406 When the concentrations of IGFBP-6 or KNG1 were greater than 98.5 pg/ml or 88.5 ng/ml, respectively, they predicted the proliferative vitreoretinopathy prognosis.
23623986 This is the first report to implicate IGFBP-6 as a suppressor of cellular proliferation and IGF-II as an inducer of cellular contractility in this connective tissue disease.
23126425 Review of the IGF system in physiology and disease with a focus on the regulation and actions of IGFBP-6, and its potential roles in cancer cells.
21997736 IGFBP-6 acts as a inhibitory mediator of thyroid hormone effects in osteoblast differentiation
21940310 Hh pathway is aberrant activation in colorectal carcinoma cell line. Its inhibitor may be effectual agent for colorectal cancer chemoprevention. Gli1 maintained cell survival by binding promoter regions and facilitating transcription of IGFBP6 and Bcl-2.
More...

AA Sequence

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE      1 - 70
CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN     71 - 140
PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG    141 - 210
PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG                                            211 - 240
//

Text Mined References (67)

PMID Year Title
26039376 2015 Whole genome methylation array reveals the down-regulation of IGFBP6 and SATB2 by HIV-1.
24747338 2014 CC chemokine ligand 18 and IGF-binding protein 6 as potential serum biomarkers for prostate cancer.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24379119 2014 Downregulation of Insulin-like growth factor binding protein 6 is associated with ACTH-secreting pituitary adenoma growth.
24182837 2013 Autoregulation of insulin-like growth factor 2 and insulin-like growth factor-binding protein 6 in periodontal ligament cells in vitro.
24003225 2013 Prohibitin-2 binding modulates insulin-like growth factor-binding protein-6 (IGFBP-6)-induced rhabdomyosarcoma cell migration.
23808406 2014 Kininogen 1 and insulin-like growth factor binding protein 6: candidate serum biomarkers of proliferative vitreoretinopathy.
23623986 2013 IGF-II and IGFBP-6 regulate cellular contractility and proliferation in Dupuytren's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23126425 2013 Insulin-like growth factor-binding protein-6 and cancer.
More...