Property Summary

NCBI Gene PubMed Count 62
Grant Count 105
R01 Count 80
Funding $7,950,081.68
PubMed Score 121.60
PubTator Score 110.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.400 0.001
ependymoma -2.700 0.000
oligodendroglioma -2.000 0.008
glioblastoma -2.900 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.900 0.001
primitive neuroectodermal tumor -2.000 0.002
tuberculosis and treatment for 3 months -1.100 0.002
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.100 0.000
lung carcinoma -1.100 0.000

Synonym

Accession P24588 A2RRB8 AKAP-5
Symbols H21
AKAP75
AKAP79

Gene

PDB

3LL8   2H9R  

Gene RIF (30)

PMID Text
25882844 human AKAP79-anchored PKC selectively phosphorylates the Robo3.1 receptor subtype on serine 1330
25637608 Cigarette smoke-induced changes in AKAP5 and AKAP12 in patients with COPD may affect efficacy of pharmacotherapy.
24962572 GPR30 interacted with membrane-associated guanylate kinases and protein kinase A-anchoring protein (AKAP) 5 in the plasma membrane in a PDZ-dependent manner.
24121510 a significant role for the AKAP5 scaffold in signaling and trafficking of the beta1-AR in cardiac myocytes and mammalian cells.
23889134 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23699529 The results of this study suggested that antagonizing the TRPV1-AKAP79 interaction will be a useful strategy for inhibiting inflammatory hyperalgesia.
23616546 Antagonizing the interaction between AKAP79 and TRPV1 inhibits inflammatory hyperalgesia.
23462372 Patients with bipolar disorder have higher density of AKAP5-expressing neurons in the anterior cingulate cortex compared with controls.
23383244 AKAP5 Pro100Leu effects on emotion processing might be task-dependent with Pro homozygotes showing lower control of emotional interference, but more efficient processing of task-relevant emotional stimuli.
23264624 the direct anchoring of both PKA and AC to TRPV1 by AKAP79/150 facilitates the response to inflammatory mediators and may be critical in the pathogenesis of thermal hyperalgesia.
More...

AA Sequence

METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASD      1 - 70
QPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSN     71 - 140
HSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVI    141 - 210
SVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEA    211 - 280
SNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEF    281 - 350
DVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN    351 - 420
KINNLLQ                                                                   421 - 427
//

Text Mined References (64)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25882844 2015 A-kinase Anchoring Protein 79/150 Recruits Protein Kinase C to Phosphorylate Roundabout Receptors.
25637608 2015 A-kinase-anchoring proteins coordinate inflammatory responses to cigarette smoke in airway smooth muscle.
24962572 2014 G protein-coupled receptor 30 (GPR30) forms a plasma membrane complex with membrane-associated guanylate kinases (MAGUKs) and protein kinase A-anchoring protein 5 (AKAP5) that constitutively inhibits cAMP production.
24121510 2013 Role of AKAP79/150 protein in ?1-adrenergic receptor trafficking and signaling in mammalian cells.
23889134 2013 AKAP79, PKC, PKA and PDE4 participate in a Gq-linked muscarinic receptor and adenylate cyclase 2 cAMP signalling complex.
23699529 2013 Mapping the binding site of TRPV1 on AKAP79: implications for inflammatory hyperalgesia.
23616546 2013 Disrupting sensitization of transient receptor potential vanilloid subtype 1 inhibits inflammatory hyperalgesia.
23462372 2013 Increased density of AKAP5-expressing neurons in the anterior cingulate cortex of subjects with bipolar disorder.
23383244 2013 Effects of AKAP5 Pro100Leu genotype on working memory for emotional stimuli.
More...