Property Summary

NCBI Gene PubMed Count 63
PubMed Score 126.27
PubTator Score 110.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.300 8.4e-04
astrocytic glioma -1.500 1.7e-02
Astrocytoma, Pilocytic -2.100 3.8e-05
atypical teratoid / rhabdoid tumor -2.700 1.7e-07
ependymoma -1.700 2.3e-02
glioblastoma -2.000 7.2e-07
group 4 medulloblastoma -2.500 2.5e-04
lung carcinoma -1.100 4.1e-09
medulloblastoma, large-cell -2.900 7.2e-04
oligodendroglioma -1.600 1.9e-02
primitive neuroectodermal tumor -2.000 2.4e-03
tuberculosis and treatment for 3 months -1.100 2.2e-03

Protein-protein Interaction (2)

Gene RIF (31)

AA Sequence

METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASD      1 - 70
QPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSN     71 - 140
HSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVI    141 - 210
SVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEA    211 - 280
SNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEF    281 - 350
DVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN    351 - 420
KINNLLQ                                                                   421 - 427
//

Text Mined References (65)

PMID Year Title