Property Summary

NCBI Gene PubMed Count 74
Grant Count 41
R01 Count 28
Funding $3,477,106.35
PubMed Score 1228.86
PubTator Score 91.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.560 0.005
tuberculosis 1.900 0.000
non-small cell lung cancer -1.035 0.000
lung cancer -1.200 0.018
active ulcerative colitis 1.528 0.007
interstitial cystitis 1.300 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.547 0.021
lung carcinoma -2.000 0.000
gastric carcinoma 1.100 0.034

Gene RIF (41)

PMID Text
26974824 the administration of salted drinking water (2.7% NaCl) to wild-type mice resulted in elevated placental TXA2 synthase (TXAS) and plasma thromboxane A2, but not prostacyclin, levels, which was also found in clinical preeclampsia placenta samples.
26252103 Single nucleotide polymorphisms of TBXAS1 are associated with susceptibility to gout in ethnic Han males population.
26117917 The cardiovascular events significantly morefrequently occurred during 12 and 18 months in resistant diabetics and in the patients with an allele lacking the *2/*3 CYP2C9 gene function and AT/TT polymorphism of the thromboxane synthase gene TBS1.
26027242 The carriage of Thromboxane A synthase 1 gene polymorphism AA was shown to affect the risk of clopidogrel resistance.
24556579 study suggests that the anti-tumor effect of glycyrrhizin in lung adenocarcinoma is, at least in part, TxAS-dependent.
24009185 12-HHT is produced by both TxAS-dependent and TxAS-independent pathways in vitro and in vi
23763970 In this study we have showed, for the first time, a significant role of the minor allele rs6962291 of TBXAS1 in patients with NSAID acute cutaneous hypersensitivity.
22735388 The increased Km and decreased Vmax values observed with L357V suggest that this variant may generate less TXA2 at the low levels of PGH2 expected in vivo, raising the possibility of attenuated signaling through the thromboxane pathway.
22493072 Data show that that DNA methylation of the TBXAS1 promoter was decreased and thromboxane synthase expression was increased in omental arteries of preeclamptic women as compared with normal pregnant women.
22293189 these results showed that visfatin promoted IL-8 production by upregulation of TXAS, leading to angiogenic activation in endothelial cells.
More...

AA Sequence

MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMEL      1 - 70
RKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALM     71 - 140
SAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFV    141 - 210
KHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQ    211 - 280
MVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTL    281 - 350
SFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV    351 - 420
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK    421 - 490
LTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR                               491 - 533
//

Text Mined References (78)

PMID Year Title
26974824 2016 Lack of Thromboxane Synthase Prevents Hypertension and Fetal Growth Restriction after High Salt Treatment during Pregnancy.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
26117917 2015 [CLINICAL AND PHARMACOLOGICAL FACTORS INFLUENCING RESISTANCE TO CLOPIDOGREL IN PATIENTS WITH CARDIOVASCULAR DISEASES].
26027242 2015 [Positive effect of low-activity thromboxane A synthase gene on prognosis in coronary heart disease].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24556579 2014 Glycyrrhizin suppresses lung adenocarcinoma cell growth through inhibition of thromboxane synthase.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086445 2013 Genome-wide association analysis with gray matter volume as a quantitative phenotype in first-episode treatment-naïve patients with schizophrenia.
24009185 2013 Thromboxane A synthase-independent production of 12-hydroxyheptadecatrienoic acid, a BLT2 ligand.
More...