Property Summary

Ligand Count 609
NCBI Gene PubMed Count 77
PubMed Score 1395.91
PubTator Score 91.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Asthma 385
Spasm of cerebral arteries 3
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 1.4

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.528 7.3e-03
Astrocytoma, Pilocytic 1.200 2.5e-07
gastric carcinoma 1.100 3.4e-02
interstitial cystitis 1.200 1.3e-03
lung cancer -1.200 1.8e-02
lung carcinoma -2.000 5.4e-26
non-small cell lung cancer -1.035 9.0e-11
osteosarcoma -1.560 5.0e-03
subependymal giant cell astrocytoma 1.547 2.1e-02
tuberculosis 1.900 3.6e-07

Protein-protein Interaction (1)

Gene RIF (44)

AA Sequence

MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMEL      1 - 70
RKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALM     71 - 140
SAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFV    141 - 210
KHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQ    211 - 280
MVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTL    281 - 350
SFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV    351 - 420
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK    421 - 490
LTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR                               491 - 533
//

Text Mined References (81)

PMID Year Title