Property Summary

NCBI Gene PubMed Count 27
PubMed Score 5.36
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 1.2e-02
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
breast carcinoma 1.200 9.7e-03
interstitial cystitis -1.200 1.0e-03
medulloblastoma, large-cell -1.300 2.5e-04
Multiple myeloma 2.057 4.1e-05
oligodendroglioma -1.500 1.6e-02
ovarian cancer -1.400 2.6e-03
pituitary cancer 1.300 2.8e-05
ulcerative colitis -1.200 2.9e-06
Waldenstrons macroglobulinemia 1.522 3.2e-03

Gene RIF (7)

AA Sequence

MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPK      1 - 70
TGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQ     71 - 140
ASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRK    141 - 210
EQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM                            211 - 256
//

Text Mined References (31)

PMID Year Title