Property Summary

NCBI Gene PubMed Count 27
PubMed Score 5.85
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
ulcerative colitis 2087 2.89307350353528E-6
pituitary cancer 1972 2.80244043160399E-5
atypical teratoid / rhabdoid tumor 4369 3.6890451778778E-5
Multiple myeloma 1328 4.08512247162754E-5
medulloblastoma, large-cell 6234 2.54619658934101E-4
interstitial cystitis 2299 0.00100400567153351
ovarian cancer 8492 0.00116604372884248
Waldenstrons macroglobulinemia 765 0.0031771783913894
breast carcinoma 1614 0.00966276454604234
astrocytic glioma 2241 0.0121171981160635
oligodendroglioma 2849 0.015734820021893
Disease Target Count Z-score Confidence
glucocorticoid-induced osteoporosis 3 3.616 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.522 0.003
Multiple myeloma 2.057 0.000
astrocytic glioma -1.500 0.012
oligodendroglioma -1.500 0.016
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.300 0.000
breast carcinoma 1.200 0.010
interstitial cystitis -1.200 0.001
ulcerative colitis -1.200 0.000
ovarian cancer 2.100 0.001
pituitary cancer 1.300 0.000

Synonym

Accession P24539 Q9BQ68 Q9BRU8
Symbols PIG47

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (7)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, mitochondrial Fo complex, subunit B1 (ATP5F1) expression by HIV-1 Vpr in Vpr transduced macrophages
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, mitochondrial Fo complex, subunit B1 (ATP5F1) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
20038517 Down-regulation of mitochondrial ATPase by hypermethylation mechanism in chronic myeloid leukemia is associated with multidrug resistance.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19650768 Nitration of tyrosine residues 368 and 345 in the beta-subunit elicits FoF1-ATPase activity loss.
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPK      1 - 70
TGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQ     71 - 140
ASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRK    141 - 210
EQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM                            211 - 256
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20038517 2010 Down-regulation of mitochondrial ATPase by hypermethylation mechanism in chronic myeloid leukemia is associated with multidrug resistance.
19946888 2010 Defining the membrane proteome of NK cells.
More...