Property Summary

NCBI Gene PubMed Count 34
PubMed Score 54.32
PubTator Score 28.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Echinococcosis 26 3.677 1.8

Expression

Gene RIF (4)

AA Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP      1 - 70
GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS     71 - 140
SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF    141 - 210
EDYVQSMDVAAFNKI                                                           211 - 225
//

Text Mined References (52)

PMID Year Title