Property Summary

NCBI Gene PubMed Count 193
Grant Count 362
R01 Count 213
Funding $45,456,430.85
PubMed Score 1672.03
PubTator Score 600.15

Knowledge Summary

Patent (27,777)

TINX Plot

  Disease Relevance (63)

Disease Z-score Confidence
Hirschsprung's disease 42 8.09 4.0
Waardenburg's syndrome 16 5.805 2.9
Ritter's disease 10 5.68 2.8
Hypertension 287 5.091 2.5
Impetigo 9 5.082 2.5
Multiple endocrine neoplasia type 2A 22 4.757 2.4
Intestinal obstruction 16 4.704 2.4
Toxic shock syndrome 28 4.311 2.2
Mowat-Wilson syndrome 12 4.145 2.1
Multiple endocrine neoplasia type 2B 16 3.918 2.0
Goldberg-Shprintzen syndrome 8 3.888 1.9
Constipation 43 3.744 1.9
Cancer 2,346 3.718 1.9
Hepatopulmonary syndrome 6 3.677 1.8
ABCD syndrome 1 3.67 1.8
Sensorineural hearing loss 107 3.652 1.8
tuberculosis 1,557 3.62 1.8
Kidney disease 396 3.554 1.8
Heart disease 279 3.368 1.7
Cerebrovascular disease 231 3.044 1.5
Carcinoma 2,147 1.0
Diabetes Mellitus, Non-Insulin-Dependent 157
Diaphragmatic Hernia 40
Down syndrome 548
HIRSCHSPRUNG DISEASE, SUSCEPTIBILITY TO,... 1 
Hirschsprung Disease 11
Mammary Neoplasms 410
Multiple myeloma 1,327
Neoplasm Invasiveness 127
Nephrosis 18
Pick disease 1,893
Pulmonary hypertension 52
Subarachnoid Hemorrhage 5
Systemic sclerosis 2
WAARDENBURG SYNDROME, TYPE 4A 3
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
astrocytoma 1,493
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
gastric carcinoma 832
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nephrosclerosis 329
non-inflammatory breast cancer 208
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
posterior fossa group B ependymoma 1,530
pulmonary arterial hypertension 36
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Synonym

Accession P24530 A2A2Z8 A8K3T4 O15343 Q59GB1 Q5W0G9 Q8NHM6 Q8NHM7 Q8NHM8 Q8NHM9 Q9UD23 Q9UQK3 ET-B
Symbols ETB
ET-B
ETB1
ETBR
ETRB
HSCR
WS4A
ABCDS
ET-BR
HSCR2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
More...

Gene RIF (162)

PMID Text
26308584 culturing of reconstructed skin with microvascular endothelial cells led to increased skin pigmentation that could be prevented by inhibiting EDNRB
26240367 EDNRB plays a key role in hypoxia tolerance
26030901 The increased gene expression of MITF and EDNRB in UVB-exposed NHMs.
25946671 Endothelin receptor B expression was significantly lower while higher staining grade was found in basal cell carcinoma rather than squamous cell carcinoma or psoriasis.
25799405 Polymorphisms of the EDNRB gene may influence the susceptibility to obesity and can interact with plasma arsenic levels
25638620 Cumulative effects of the RET and EDNRB genes contribute to long-segment and total colonic aganglionosis.
25572612 Pancreatic adenocarcinoma was characterised by greater expression of ET-1 and endothelin B receptor.
25479176 The results show that MitA can effectively be used to block ETBR mediated vasoconstriction as a supplement to an existing ischemic stroke therapy.
25433721 Its expression by lymphoma and endothelial cells may mediate trafficking of tumor-infiltrated lymphocytes, which may explain the immune escape processes of primary central nervous system lymphomas.
25381251 Data show that upon endothelin-1 (ET-1) stimulation, ET type A receptor (ETAR) is recycled back to plasma membrane, whereas ET type B receptor (ETAR) is targeted to lysosome for degradation.
More...

AA Sequence

MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAE      1 - 70
VPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILI     71 - 140
ASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIK    141 - 210
GIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSF    211 - 280
YFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLY    281 - 350
NQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC    351 - 420
LKFKANDHGYDNFRSSNKYSSS                                                    421 - 442
//

Text Mined References (195)

PMID Year Title
26308584 2015 Endothelial Cells Promote Pigmentation through Endothelin Receptor B Activation.
26240367 2015 Endothelin receptor B, a candidate gene from human studies at high altitude, improves cardiac tolerance to hypoxia in genetically engineered heterozygote mice.
26030901 2015 UVB Stimulates the Expression of Endothelin B Receptor in Human Melanocytes via a Sequential Activation of the p38/MSK1/CREB/MITF Pathway Which Can Be Interrupted by a French Maritime Pine Bark Extract through a Direct Inactivation of MSK1.
25946671 2015 Immunohistochemical assessment of endothelin-1 axis in psoriasis, basal cell carcinoma and squamous cell carcinoma.
25799405 2015 Polymorphisms in endothelin system genes, arsenic levels and obesity risk.
25638620 2015 Clinical and genetic correlations of familial Hirschsprung's disease.
25572612 2015 Endothelin-1 and endothelin B receptor expression in pancreatic adenocarcinoma.
25479176 2014 Regulatory mechanism of endothelin receptor B in the cerebral arteries after focal cerebral ischemia.
25433721 2015 Perivascular microenvironment in primary central nervous system lymphomas: the role of chemokines and the endothelin B receptor.
25381251 2014 Agonist-promoted ubiquitination differentially regulates receptor trafficking of endothelin type A and type B receptors.
More...