Property Summary

NCBI Gene PubMed Count 138
Grant Count 230
R01 Count 165
Funding $12,493,137.72
PubMed Score 356.63
PubTator Score 344.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24522 Q5TCA7 Q5TCA8
Symbols DDIT1
GADD45

Gene

PDB

2KG4  

 GO Function (1)

Gene RIF (111)

PMID Text
26602816 Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs.
26546041 these data suggest a dual function of GADD45a in oxidative DNA demethylation, to promote directly or indirectly TET1 activity and to enhance subsequent 5-formylcytosine/5-carboxylcytosine removal.
26545365 MiR-362-5p promotes the malignancy of chronic myelocytic leukaemia via down-regulation of GADD45alpha
26422378 These data suggest that GADD45A (1506T>C) is a new tumor susceptibility gene and could be a useful molecular marker for assessing ovarian cancer risk and for predicting ovarian cancer patient prognosis.
26171936 Serum GADD45a methylation in combination with PSA and fcDNA level was useful in distinguishing benign from prostate cancer patients.
26022109 BRCA1 may act as an important negative regulator in cell cycle progression and tumorigenesis through regulating the stability of Smad4; this defines a novel link that connects BRCA1 to TGF-beta1/Smad pathway.
25899090 GADD45A mRNA expression was significantly greater in patients with SLE compared to controls.
25846475 Data showed that upregulation of cytoplasmic AFP is associated with down-regulation of GADD45a in hepatocellular neoplastic tissues and that AFP mediated downregulation of GADD45a to accelerate aberrant growth of HBV infected cells.
25561743 results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity.
25560476 Report GADD45alpha luciferase reporter assays in human cells for assessing the genotoxicity of environmental pollutants.
More...

AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA      1 - 70
LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL     71 - 140
SQLICFCRESRYMDQWVPVINLPER                                                 141 - 165
//

Text Mined References (141)

PMID Year Title
26602816 2015 A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy.
26546041 GADD45a physically and functionally interacts with TET1.
26545365 2015 MiR-362-5p promotes the malignancy of chronic myelocytic leukaemia via down-regulation of GADD45?.
26422378 2015 The GADD45A (1506T>C) Polymorphism Is Associated with Ovarian Cancer Susceptibility and Prognosis.
26171936 2015 Serum GADD45a methylation is a useful biomarker to distinguish benign vs malignant prostate disease.
26022109 2015 BRCA1 regulates transforming growth factor-? (TGF-?1) signaling through Gadd45a by enhancing the protein stability of Smad4.
25899090 2015 Hypermethylation of glucocorticoid receptor gene promoter results in glucocorticoid receptor gene low expression in peripheral blood mononuclear cells of patients with systemic lupus erythematosus.
25846475 2015 Alpha fetoprotein mediates HBx induced carcinogenesis in the hepatocyte cytoplasm.
25561743 2015 A novel post-translational modification of nucleolin, SUMOylation at Lys-294, mediates arsenite-induced cell death by regulating gadd45? mRNA stability.
25560476 2015 The development of GADD45? luciferase reporter assays in human cells for assessing the genotoxicity of environmental pollutants.
More...