Property Summary

NCBI Gene PubMed Count 138
PubMed Score 356.63
PubTator Score 344.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.200 2.0e-06
glioblastoma 2.000 3.8e-03
osteosarcoma -1.924 7.5e-03
Duchenne muscular dystrophy 1.933 2.5e-10
autosomal dominant Emery-Dreifuss muscul... 2.158 4.3e-04
juvenile dermatomyositis 2.084 2.1e-12
limb girdle muscular dystrophy 2B 1.178 2.4e-04
Amyotrophic Lateral Sclerosis 2.233 3.5e-08
acute quadriplegic myopathy 2.955 2.7e-08
adrenocortical carcinoma 1.100 1.5e-02
tuberculosis -1.300 2.4e-04
primary pancreatic ductal adenocarcinoma 1.466 5.1e-03
lung cancer 1.400 2.0e-04
pediatric high grade glioma 1.100 2.0e-03
group 3 medulloblastoma 1.100 1.8e-02
pilocytic astrocytoma 1.500 1.7e-06
pancreatic cancer 1.400 1.1e-03
dermatomyositis 1.300 2.9e-03

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (111)

PMID Text
26602816 Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs.
26546041 these data suggest a dual function of GADD45a in oxidative DNA demethylation, to promote directly or indirectly TET1 activity and to enhance subsequent 5-formylcytosine/5-carboxylcytosine removal.
26545365 MiR-362-5p promotes the malignancy of chronic myelocytic leukaemia via down-regulation of GADD45alpha
26422378 These data suggest that GADD45A (1506T>C) is a new tumor susceptibility gene and could be a useful molecular marker for assessing ovarian cancer risk and for predicting ovarian cancer patient prognosis.
26171936 Serum GADD45a methylation in combination with PSA and fcDNA level was useful in distinguishing benign from prostate cancer patients.
26022109 BRCA1 may act as an important negative regulator in cell cycle progression and tumorigenesis through regulating the stability of Smad4; this defines a novel link that connects BRCA1 to TGF-beta1/Smad pathway.
25899090 GADD45A mRNA expression was significantly greater in patients with SLE compared to controls.
25846475 Data showed that upregulation of cytoplasmic AFP is associated with down-regulation of GADD45a in hepatocellular neoplastic tissues and that AFP mediated downregulation of GADD45a to accelerate aberrant growth of HBV infected cells.
25561743 results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity.
25560476 Report GADD45alpha luciferase reporter assays in human cells for assessing the genotoxicity of environmental pollutants.
25469469 Induction of GADD45alpha protects M17 neuroblastoma cells against MPP+.
25450267 Knockdown of Gadd45a gene abolished the G2/M arrest.
25449331 High GADD45A expression is associated with response to low intravenous immunoglobulin therapy in patients with Kawasaki disease.
25087872 Results show TARID binds to the TCF21 promoter and recruits GADD45A and TDG to direct base excision repair for demethylation.
24940746 GADD45a promoter regulation by a functional genetic variant is associated with acute mechanical lung injury.
24894488 the present results revealed, for the first time, that Hes-1 could be SUMO-modified by PIAS1 and GADD45alpha is a novel target of Hes-1
24755561 DNA damage-inducible transcript 1 protein(Gadd45alpha) may be involved in human trophoblast migration and invasion and may function as an important negative regulator at the foetal-maternal interface during early pregnancy
24464562 Individuals carrying the GADD45Ars532446 genotype were at higher risk for chromosomal damage compared with the wild type genotype.
24177565 we conclude that repair, together with Gadd45 and MDM2 genes, were involved in light and dark reaction mechanisms.
24104476 The Gadd45A protein is a stress sensor in preeclampsia.
24104471 The gadd45a gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review)
24104470 Gadd45a, encodes a ubiquitously expressed protein that is often induced by DNA damage and other stress signals associated with growth arrest and apoptosis. (Review)
24062075 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
23846616 the promotion of base excision repair activity by a p53-dependent pathway is mediated by an interaction between Gadd45a, PCNA and APE1 in the presence of organic selenium that results in increased APE1 activity
23706118 Gadd45a levels are significantly associated with hormone receptor status in human breast cancer
23616123 Methylation-mediated repression of GADD45A expression is associated with gastric cardia adenocarcinoma.
23603344 The absolute mRNA content of paraffin embedded samples of salivary gland cancer was determined by quantitative reverse transcription-PCR using specific primers for NFkB1, GADD45A and JNK1.
23485469 Proliferating cell nuclear antigen (PCNA) binding site on Gadd45alpha plays a critical role in modulating the interaction with PCNA and APE1, affecting base excision repair.
23478041 Data indicate that salivary gland epithelial cells (SGEC) demethylation in Sjogren's syndrome (SS)patients was associated with a 7-fold decrease in DNA methyl transferase DNMT1 and a 2-fold increase in Gadd45-alpha expression.
23227140 reduced Gadd45alpha protein expression by forced miR-499 expression indicated it's a diabetes-associated gene which might potentially be involved in both DCM and DM-induced baroreflex dysfunction
23187294 GADD45A hyper-methylation may be detecting a broader epigenetic phenotype in acute myeloid leukemia.
23158659 The expressions of p21(Cip1/WAF1), Gadd45alpha and p53 are associated with the clinicopathologic features and prognosis in breast cancer.
23114628 Hepatitis C virus NS5A repressed p53 expression, which was followed by a subsequent decrease in GADD45alpha expression, which triggered cellular proliferation.
23071284 the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription
22970179 The expression of Gadd45a in normal, developing brain is tightly regulated.
22825327 To examine the functions of Gadd45a in cell invasion and metastasis, we performed the adhesion, wound-healing and transwell assays in Gadd45a (+/+) and Gadd45a (-/-) MEF cell lines.
22718299 The induction of Gadd45a in response to preeclampsia stresses was associated with the activation of its downstream effectors phospho-p38 and phospho-JNK. Soluble Flt-1 levels were subsequently regulated through one of these effectors, but not both.
22521726 AK inhibitor MK-0457 induces the growth arrest DNA damage-inducible (Gadd) 45a through recruitment of octamer-binding (Oct)-1 transcription factor at a critical promoter region for gene transcription and covalent modifications of histone H3.
22430142 the increased expression of GADD45A under the above experimental conditions, NAMPT inhibition by FK866, involves acetylation of FOXO3a, a member of the important family of forkhead (FOXO) proteins.
22313682 Overexpression of DNA damage-induced 45 alpha gene contributes to esophageal squamous cell cancer by promoter hypomethylation
21986581 [review] Decreased inducibility of Gadd45 members has far-reaching consequences including genome instability, DNA damage, and disorders in cellular homeostasis, which contribute to the aging process and age-related disorders.
21931671 Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation.
21813510 our studies demonstrate that upregulation of Gadd45a or suppression of MMP-9 (pM) with ionizing radiation retards medulloblastoma tumor metastatic potential.
21739277 Transient expression of GADD45alpha and AP-1 family transcription factors is sufficient to induce apoptosis in acute myeloid leukemia.
21368893 Gadd45alpha is a main host cell player in triggering the death of the cells infected by Shigella.
21211282 Gadd45alpha mRNA and protein levels in placenta tissues of patients with preeclampsia are higher than that of normotensive women, and up-regulated with aggravation of preeclampsia.
21120602 Estrogen receptor beta causes a G2 cell cycle arrest by inactivating CDK1 through the repression of cyclin B1 and stimulation of GADD45A and BTG2 expression.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20652500 Finding suggests that methylation-associated down-regulation of the GADD45G gene may be involved in lung tumorigenesis.
20460379 Aurora A interacts through its N-terminal domain with a region of human Gadd45alpha and Gadd45alpha appears to interact only weakly with PCNA through its flexible loop.
20444249 Observational study of gene-disease association. (HuGE Navigator)
20131288 gadd45A may contribute to lupus-like autoimmunity by promoting DNA demethylation in systemic lupus erythematosus CD4+ T cells
20012529 HIV-1 Vpr upregulates GADD45alpha protein levels in primary CD4+ lymphocytes and SupT1 cells; knockdown of GADD45alpha by GADD45alpha siRNA relieves Vpr-induced apoptosis
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19728081 polymorphisms/haplotypes in GADD45A contribute to breast cancer risk, at least to sporadic breast cancer
19728081 Observational study of gene-disease association. (HuGE Navigator)
19596022 Individuals carrying GADD45A rs581000 GG and rs532446 TC+CC genotypes may have lower risk of chronic benzene poisoning; however, after adjustment for potential confounders, this difference disappeared.
19596022 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19550118 Data show that wt-p53 can suppress excessive replication of centrosomes that may contribute to the upregulation of Gadd45a and BubR1 protein expression as well as the downregulation of Aurora A protein expression.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19459735 Expression of gadd45a, known to involve base excision repair as one of the p53 downstream genes, was increased by Selenomethionine in p53 wild-type RKO cells.
19452502 Gadd45a stress signaling regulates sFlt-1 expression in preeclampsia.
19298651 all T-cell acute lymphoblastic leukemia patients showed an upregulation of all proteins studied and the high expression of GADD45a was associated to the lowest DFS median (p = 0.04).
19190346 Repression of GADD45A may be a potential target for the treatment of prostatic cancer.
19128509 No mutation of the Gadd45 gene at exon 4 was observed in a series of 6 atypical fibroxanthoma cases
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19052873 GADD45alpha may play a role in drug-induced apoptosis, as well as multidrug resistance in osteosarcoma cells
19048389 Flow cytometric analysis revealed significant G2/M arrest in cells transfected with either Gadd45alpha or Gadd45gamma. Importantly, we found that expression of either Gadd45alpha or Gadd45gamma activated P38 and JNK kinase pathways to induce G2/M arrest.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18760377 GADD45alpha is an essential component of many metabolic pathways that control proliferating cancer cells, it presents itself as an emerging drug target worthy of further investigation.
18611122 Review GADD45a-GFP GreenScreen HC genotoxicity screening assay.
18480060 MMR-dependent intrinsic apoptosis is p53-independent, but stimulated by hMLH1/c-Abl/p73alpha/GADD45alpha retrograde signaling
18472964 Epigenetic inactivation by methylation of GADD45A gene is associated with osteosarcoma
18413758 GADD45 alpha knockdown attenuated the G(2) arrest induced by AKT inhibition in soft tissue sarcoma cells.
18369439 we were unable to substantiate a functional role of GADD45A in DNA demethylation
18350249 characterization of the entire coding sequence, intron/exon boundaries, and p53- and ZNF350-binding sequences of this potential breast cancer susceptibility candidate gene in a sample set of 96 women affected with breast cancer
18350249 Observational study of gene-disease association. (HuGE Navigator)
18296737 enhanced phosphorylation of p38 and p53 (ser15) in ZS cells was normalized after suppression of Gadd45 by siRNA
18243530 We propose that BARD1 reduces BRCA1 transcriptional activity, and that this at least partly involves BRCA1/BARD1 E3 ubiquitin ligase activity, which is disrupted by the C61G mutation.
17703175 UVB-induced Gadd45a overexpression protects melanoma cells from apoptosis, both by causing a G2 cell cycle arrest and by inhibiting the mitochondrial apoptotic pathway.
17616671 in growth-arrested cells, As(3+) is still capable of inducing GADD45 alpha expression through an IRES-dependent translational regulation
17599061 Gadd45a-deficient human colon cancer cells exhibited slow base excision repair after treatment with methyl methanesulfonate, a pure base-damaging agent.
17474084 Induction of GADD45A expression might play a role in mediating the apoptotic response of ovarian cancer cells to the synthetic retinoid CD437.
17436581 Fucoxanthin induced G1 arrest in HepG2 and DU145 cells and GADD45A may be involved in fucoxanthin-induced G1 arrest in cancer cels.
17230496 Overexpression of Gadd45a is associated with pancreatic cancer
17178890 Establish MDA-7/IL-24 and GADD45alpha and GADD45gamma as critical mediators of apoptosis and growth arrest in response to NSAIDs in cancer cells.
17140287 In support of the idea that checkpoint activation and apoptosis induction are functionally linked, we show that Bax activation by Vpr was ablated when ATR or GADD45alpha was knocked down
16997058 Reverse-transcription polymerase chain reaction confirmed increased expression of GADD45A, BTG2, PDE4B, and CEBPD and downregulation of TOB1 in skeletal muscle intradialysis.
16951143 p53 preferentially occupied the promoters of growth arrest genes p21 and GADD45 in senescent normal human diploid fibroblasts.
16827157 The overall median mRNA expression level of Gadd45 was approximately 10-fold lower in tumor tissues than in matching normal lung tissues. High intratumoral Gadd45 expression was significantly associated with a poorer histological grading.
16772293 Gadd45a interacts with aurora-A and inhibits its kinase activity
16353139 findings provide evidence that GADD45alpha contributes to pancreatic cancer cell proliferation and viability
16157202 We conclude that the GADD45A gene is not involved in meningioma tumorigenesis.
15899854 Gadd45a is involved in the induction of apoptosis, inhibiting microtubule stability and inducing Bim translocation to mitochondria.
15736438 Expression of CDKN1A and Gadd45 proteins acting on cell cycle checkpoints and DNA repair in PCa relative to the presence of oxidative DNA damage was measured.
15735726 The CpG island associated with GADD45a was analysed Four CpG's, located approximately 700 bp upstream of the transcriptional start site are methylated in the majority of breast cancer cell lines and primary tumors
15650754 HIV-1 Vpr upregulates GADD45alpha protein levels in primary CD4+ lymphocytes and SupT1 cells; knockdown of GADD45alpha by GADD45alpha siRNA relieves Vpr-induced apoptosis
15644315 a novel association of B23 and Gadd45a and implicate B23 as an important regulator in Gadd45a nuclear import.
15642443 Observational study of gene-disease association. (HuGE Navigator)
15353598 Inhibition of GADD45alpha and gamma in cancer cells by small interfering RNA abrogates apoptosis induction by the inhibitor of NF-kappaB
15203190 Akt and P70S6K phosphorylation and Gadd45 levels are modulated by GPx-1 in tumor cells
14647444 Silencing of GADD45gamma, a negative regulator of cell growth, is most likely responsible for conferring a selective growth advantage during tumour evolution and outgrowth
14635187 These findings suggest that phenethylisothiocyanate creates an oxidative cellular environment that induces DNA damage and GADD153, 34 and 45 gene activation, which in turn helps trigger apoptosis.
14586402 Histone deacetylase inhibitors can induce Gadd45 through its promoter without the need for functional p53, and both Oct-1 and NF-Y concertedly participate in trichostatin A-induced activation of the gadd45 promoter.
14517299 Gadd45a transcription is repressed through ZBRK1 binding to a specific sequence in intron 3
14506229 GADD45 is an important mediator for the tumor-suppressing activity of 1,25-dihydroxyvitamin D3 in human ovarian cancer cells
12483522 role in G2-M arrest is associated with altered subcellular distribution of cyclin B1 and is independent of p38 kinase activity
12171872 GADD45a has a role in pancreatic cancer [review]
12168790 GADD 45 may play an important role in melanoma progression
11893252 Early induction of CDKN1A (p21) and GADD45 mRNA by a low dose of ionizing radiation is due to their dose-dependent post-transcriptional regulation.
11777930 immunodepletion of Oct-1 and NF-YA proteins or mutations in the OCT-1 and CAAT motifs disrupt BRCA1 binding to the GADD45 promoter

AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA      1 - 70
LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL     71 - 140
SQLICFCRESRYMDQWVPVINLPER                                                 141 - 165
//

Text Mined References (141)

PMID Year Title
26602816 2015 A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy.
26546041 GADD45a physically and functionally interacts with TET1.
26545365 2015 MiR-362-5p promotes the malignancy of chronic myelocytic leukaemia via down-regulation of GADD45?.
26422378 2015 The GADD45A (1506T>C) Polymorphism Is Associated with Ovarian Cancer Susceptibility and Prognosis.
26171936 2015 Serum GADD45a methylation is a useful biomarker to distinguish benign vs malignant prostate disease.
26022109 2015 BRCA1 regulates transforming growth factor-? (TGF-?1) signaling through Gadd45a by enhancing the protein stability of Smad4.
25899090 2015 Hypermethylation of glucocorticoid receptor gene promoter results in glucocorticoid receptor gene low expression in peripheral blood mononuclear cells of patients with systemic lupus erythematosus.
25846475 2015 Alpha fetoprotein mediates HBx induced carcinogenesis in the hepatocyte cytoplasm.
25561743 2015 A novel post-translational modification of nucleolin, SUMOylation at Lys-294, mediates arsenite-induced cell death by regulating gadd45? mRNA stability.
25560476 2015 The development of GADD45? luciferase reporter assays in human cells for assessing the genotoxicity of environmental pollutants.
25469469 2014 Induction of GADD45? protects M17 neuroblastoma cells against MPP*.
25450267 2014 Expression of growth arrest and DNA damage inducible 45a in human oral squamous cell carcinoma is associated with tumor progression and clinical outcome.
25449331 2015 Exploring the genes associated with the response to intravenous immunoglobulin in patients with Kawasaki disease using DNA microarray analysis.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25087872 2014 Long noncoding RNA TARID directs demethylation and activation of the tumor suppressor TCF21 via GADD45A.
24940746 2014 GADD45a promoter regulation by a functional genetic variant associated with acute lung injury.
24894488 2014 Hes-1 SUMOylation by protein inhibitor of activated STAT1 enhances the suppressing effect of Hes-1 on GADD45? expression to increase cell survival.
24755561 2014 Expression of Gadd45? in human early placenta and its role in trophoblast invasion.
24464562 2013 Polymorphisms in the p53 pathway genes and micronucleus occurrence in Chinese vinyl chloride-exposed workers.
24177565 2013 Protective roles of Gadd45 and MDM2 in blueberry anthocyanins mediated DNA repair of fragmented and non-fragmented DNA damage in UV-irradiated HepG2 cells.
24104476 2013 Gadd45 stress sensors in preeclampsia.
24104471 2013 Gadd45 in modulation of solid tumors and leukemia.
24104470 2013 Gadd45 in stress signaling, cell cycle control, and apoptosis.
24062075 2013 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
23846616 2013 A novel chemopreventive mechanism of selenomethionine: enhancement of APE1 enzyme activity via a Gadd45a, PCNA and APE1 protein complex that regulates p53-mediated base excision repair.
23820005 2013 Activation-induced cytidine deaminase auto-activates and triggers aberrant gene expression.
23706118 2013 Gadd45a levels in human breast cancer are hormone receptor dependent.
23616123 2013 Methylation-mediated repression of GADD45A and GADD45G expression in gastric cardia adenocarcinoma.
23603344 Expression of NFkB1, GADD45A and JNK1 in salivary gland carcinomas of different histotypes.
23485469 2013 A novel role for Gadd45? in base excision repair: modulation of APE1 activity by the direct interaction of Gadd45? with PCNA.
23478041 2013 Epigenetic dysregulation in salivary glands from patients with primary Sjögren's syndrome may be ascribed to infiltrating B cells.
23227140 2012 Gadd45?: a novel diabetes-associated gene potentially linking diabetic cardiomyopathy and baroreflex dysfunction.
23187294 2013 GADD45A methylation predicts poor overall survival in acute myeloid leukemia and is associated with IDH1/2 and DNMT3A mutations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158659 2012 [Significance and expression of p53, p21(Cip1/WAF1) and Gadd45? in breast neoplasm tissues].
23114628 2013 p53 controls hepatitis C virus non-structural protein 5A-mediated downregulation of GADD45? expression via the NF-?B and PI3K-Akt pathways.
23071284 2012 APRIL binding to BCMA activates a JNK2-FOXO3-GADD45 pathway and induces a G2/M cell growth arrest in liver cells.
22970179 2012 Abnormal levels of Gadd45alpha in developing neocortex impair neurite outgrowth.
22825327 2012 Gadd45a inhibits cell migration and invasion by altering the global RNA expression.
22718299 2013 Preeclampsia-associated stresses activate Gadd45a signaling and sFlt-1 in placental explants.
22521726 2012 Gadd45a transcriptional induction elicited by the Aurora kinase inhibitor MK-0457 in Bcr-Abl-expressing cells is driven by Oct-1 transcription factor.
22430142 2012 NAMPT pathway is involved in the FOXO3a-mediated regulation of GADD45A expression.
22313682 2012 Overexpression of DNA damage-induced 45 ? gene contributes to esophageal squamous cell cancer by promoter hypomethylation.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21986581 2012 Gadd45 proteins: relevance to aging, longevity and age-related pathologies.
21931671 2011 Combinatorial effect of non-steroidal anti-inflammatory drugs and NF-?B inhibitors in ovarian cancer therapy.
21813510 2011 Gadd45a sensitizes medulloblastoma cells to irradiation and suppresses MMP-9-mediated EMT.
21739277 2011 The non-steroidal anti-inflammatory drugs Sulindac sulfide and Diclofenac induce apoptosis and differentiation in human acute myeloid leukemia cells through an AP-1 dependent pathway.
21722948 2011 Thymine DNA glycosylase is essential for active DNA demethylation by linked deamination-base excision repair.
21368893 2011 Gadd45? activity is the principal effector of Shigella mitochondria-dependent epithelial cell death in vitro and ex vivo.
21211282 2010 [Expression changes of the growth arrest and DNA damage 45 alpha gene in placenta in patients with preeclampsia and its clinical significance].
21120602 2011 Estrogen receptor ? causes a G2 cell cycle arrest by inhibiting CDK1 activity through the regulation of cyclin B1, GADD45A, and BTG2.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20652500 2010 Hypermethylation of growth arrest DNA-damage-inducible gene 45 in non-small cell lung cancer and its relationship with clinicopathologic features.
20460379 2010 Solution structure of human growth arrest and DNA damage 45alpha (Gadd45alpha) and its interactions with proliferating cell nuclear antigen (PCNA) and Aurora A kinase.
20444249 2010 Early onset MSI-H colon cancer with MLH1 promoter methylation, is there a genetic predisposition?
20160708 2010 Feedback between p21 and reactive oxygen production is necessary for cell senescence.
20131288 2010 Overexpression of the growth arrest and DNA damage-induced 45alpha gene contributes to autoimmunity by promoting DNA demethylation in lupus T cells.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19728081 2010 Genetic contribution of GADD45A to susceptibility to sporadic and non-BRCA1/2 familial breast cancers: a systematic evaluation in Chinese populations.
19596022 2009 Association of genetic polymorphisms in GADD45A, MDM2, and p14 ARF with the risk of chronic benzene poisoning in a Chinese occupational population.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19550118 2009 Inhibitory effect of wild-type p53 gene on excessive replication of centrosomes in leukemia cell line K562.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19459735 2009 Enhancement of methyl methanesulfonate-induced base excision repair in the presence of selenomethionine on p53-dependent pathway.
19452502 2009 Gadd45a stress signaling regulates sFlt-1 expression in preeclampsia.
19298651 2009 High Erk-1 activation and Gadd45a expression as prognostic markers in high risk pediatric haemolymphoproliferative diseases.
19190346 2009 Methylation-mediated repression of GADD45alpha in prostate cancer and its role as a potential therapeutic target.
19128509 2009 Mutation analysis of the Gadd45 gene at exon 4 in atypical fibroxanthoma.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19052873 2009 Multidrug resistant osteosarcoma cell lines exhibit deficiency of GADD45alpha expression.
19048389 2009 Gadd45-alpha and Gadd45-gamma utilize p38 and JNK signaling pathways to induce cell cycle G2/M arrest in Hep-G2 hepatoma cells.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18760377 2009 Growth arrest and DNA damage-45 alpha (GADD45alpha).
18611122 2008 GADD45a-GFP GreenScreen HC genotoxicity screening assay.
18480060 2008 DNA mismatch repair-dependent activation of c-Abl/p73alpha/GADD45alpha-mediated apoptosis.
18472964 2008 Decitabine-induced demethylation of 5' CpG island in GADD45A leads to apoptosis in osteosarcoma cells.
18413758 2008 Soft tissue sarcoma cells are highly sensitive to AKT blockade: a role for p53-independent up-regulation of GADD45 alpha.
18369439 2008 GADD45A does not promote DNA demethylation.
18350249 2008 Analysis of GADD45A sequence variations in French Canadian families with high risk of breast cancer.
18296737 2008 Suppression of Gadd45 alleviates the G2/M blockage and the enhanced phosphorylation of p53 and p38 in zinc supplemented normal human bronchial epithelial cells.
18243530 2008 BARD1 regulates BRCA1-mediated transactivation of the p21WAF1/CIP1 and Gadd45 promoters.
17703175 2008 Gadd45a activation protects melanoma cells from ultraviolet B-induced apoptosis.
17616671 2007 Incorporation of an internal ribosome entry site-dependent mechanism in arsenic-induced GADD45 alpha expression.
17599061 2007 Base excision DNA repair defect in Gadd45a-deficient cells.
17474084 2007 GADD45A is a mediator of CD437 induced apoptosis in ovarian carcinoma cells.
17436581 Fucoxanthin, a natural carotenoid, induces G1 arrest and GADD45 gene expression in human cancer cells.
17230496 2007 Expression of Gadd45a and p53 proteins in human pancreatic cancer: potential effects on clinical outcomes.
17178890 2006 A novel pathway involving melanoma differentiation associated gene-7/interleukin-24 mediates nonsteroidal anti-inflammatory drug-induced apoptosis and growth arrest of cancer cells.
17140287 2006 HIV-1 Vpr-induced apoptosis is cell cycle dependent and requires Bax but not ANT.
16997058 2006 Hemodialysis modulates gene expression profile in skeletal muscle.
16951143 2006 p53 is preferentially recruited to the promoters of growth arrest genes p21 and GADD45 during replicative senescence of normal human fibroblasts.
16827157 Down-regulation of Gadd45 expression is associated with tumor differentiation in non-small cell lung cancer.
16772293 2006 Gadd45a interacts with aurora-A and inhibits its kinase activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16421274 2006 Nucleolin links to arsenic-induced stabilization of GADD45alpha mRNA.
16381901 2006 The LIFEdb database in 2006.
16353139 2006 GADD45alpha is highly expressed in pancreatic ductal adenocarcinoma cells and required for tumor cell viability.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16157202 2005 GADD45A and EPB41 as tumor suppressor genes in meningioma pathogenesis.
15899854 2005 Gadd45a expression induces Bim dissociation from the cytoskeleton and translocation to mitochondria.
15736438 Checkpoint effectors CDKN1A and Gadd45 correlate with oxidative DNA damage in human prostate carcinoma.
15735726 2005 Analysis of methylation-sensitive transcriptome identifies GADD45a as a frequently methylated gene in breast cancer.
15644315 2005 B23 regulates GADD45a nuclear translocation and contributes to GADD45a-induced cell cycle G2-M arrest.
15642443 2005 An association study between polymorphisms in five genes in glutamate and GABA pathway and paranoid schizophrenia.
15623356 Molecular responses to stress induced in normal human caucasian melanocytes in culture by exposure to simulated solar UV.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353598 2004 NF-kappa B-mediated repression of growth arrest- and DNA-damage-inducible proteins 45alpha and gamma is essential for cancer cell survival.
15328371 2004 TAFII70 isoform-specific growth suppression correlates with its ability to complex with the GADD45a protein.
15203190 2004 GPx-1 modulates Akt and P70S6K phosphorylation and Gadd45 levels in MCF-7 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647444 2004 Loss of expression of the growth inhibitory gene GADD45gamma, in human pituitary adenomas, is associated with CpG island methylation.
14635187 2003 Induction of GADD gene expression by phenethylisothiocyanate in human colon adenocarcinoma cells.
14586402 2003 p53-independent induction of Gadd45 by histone deacetylase inhibitor: coordinate regulation by transcription factors Oct-1 and NF-Y.
14517299 2003 Degradation of transcription repressor ZBRK1 through the ubiquitin-proteasome pathway relieves repression of Gadd45a upon DNA damage.
14506229 2003 G2/M arrest by 1,25-dihydroxyvitamin D3 in ovarian cancer cells mediated through the induction of GADD45 via an exonic enhancer.
12716909 2003 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle.
12483522 2002 GADD45-induced cell cycle G2-M arrest associates with altered subcellular distribution of cyclin B1 and is independent of p38 kinase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171872 2002 Gadd45a: an elusive yet attractive candidate gene in pancreatic cancer.
12168790 2002 GADD153 is an independent prognostic factor in melanoma: immunohistochemical and molecular genetic analysis.
12052864 2002 Regulation of MTK1/MEKK4 kinase activity by its N-terminal autoinhibitory domain and GADD45 binding.
11893252 2002 Early induction of CDKN1A (p21) and GADD45 mRNA by a low dose of ionizing radiation is due to their dose-dependent post-transcriptional regulation.
11777930 2002 BRCA1 regulates GADD45 through its interactions with the OCT-1 and CAAT motifs.
11498536 2001 Oligomerization of human Gadd45a protein.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10973963 2000 Identification of a functional domain in a GADD45-mediated G2/M checkpoint.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10828065 2000 Characterization of MyD118, Gadd45, and proliferating cell nuclear antigen (PCNA) interacting domains. PCNA impedes MyD118 AND Gadd45-mediated negative growth control.
10747892 2000 The GADD45 inhibition of Cdc2 kinase correlates with GADD45-mediated growth suppression.
10097101 1999 GADD45 induction of a G2/M cell cycle checkpoint.
10022855 1999 Gadd45, a p53-responsive stress protein, modifies DNA accessibility on damaged chromatin.
9827804 1998 A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.
8226988 1993 Analysis of the mammalian gadd45 gene and its response to DNA damage.
7973727 1994 Interaction of the p53-regulated protein Gadd45 with proliferating cell nuclear antigen.
7798274 1994 Characterization of human Gadd45, a p53-regulated protein.
7478594 1995 Gadd45 is a nuclear cell cycle regulated protein which interacts with p21Cip1.
7478510 1995 Direct interaction of Gadd45 with PCNA and evidence for competitive interaction of Gadd45 and p21Waf1/Cip1 with PCNA.
1990262 1991 Induction by ionizing radiation of the gadd45 gene in cultured human cells: lack of mediation by protein kinase C.