Property Summary

NCBI Gene PubMed Count 66
Grant Count 144
R01 Count 71
Funding $30,073,894.79
PubMed Score 160.31
PubTator Score 89.68

Knowledge Summary

Patent (10,724)

Expression

Synonym

Accession P24468 B4DQJ2 B6ZGU1 Q03754 Q3KQR7 COUP-TF2
Symbols ARP1
CHTD4
NF-E3
NR2F1
SVP40
COUPTFB
TFCOUP2
COUPTFII

Gene

PDB

3CJW  

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
686940 screening 2610 / 0 / 367666 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of COUP-TFII (NR2F2)
686953 summary 0 / 0 / 0 Summary of a probe development effort to identify inhibitors of COUP-TFII (NR2F2)
687008 screening 1133 / 0 / 1364 Luminescence-based cell-based high throughput confirmation assay to identify inhibitors of COUP-TFII (NR2F2)
720548 confirmatory 173 / 0 / 59 Luminescence-based cell-based high throughput dose response assay to identify inhibitors of COUP-TFII (NR2F2)

Gene RIF (44)

PMID Text
26261604 Positive COUP-TF II expression levels has significant value in determining CRC stage and metastasis and cooperates with negative Smad4 expression contributing to assess prognosis in patients with colorectal cancer.
25687954 COUP-TFII (NR2F2) induces down-regulation of cadherin-6 and up-regulation of cadherin-11 in cultured cell lines.high expression of COUP-TFII in some gastric and oesophageal adenocarcinomas, correlated with abnormal cadherin-11 expression.
25372459 These data demonstrate that Nr2f2 is a direct target of POU4F3 in vitro and that this regulatory relationship may be relevant to hair cell development and survival.
25129343 TGF-beta inhibited the expression of NR2F2.
25032732 Overexpression of COUP-TFII was required for cancer cells to metastasise in vivo.
24702954 showed that all six coding sequence variants observed in individuals significantly alter the activity of NR2F2 on target promoters
24176914 COUP-TFII plays a role in controlling the expression of inflammatory cytokines.
24141032 These data indicate a novel role for COUP-TFII in suppression of NFkappaB activity.
24122412 In vitro silencing of COUP-TFII reduces the cell growth.
24058409 Using several human red opsin enhancer/promoter-luciferase reporter constructs, the study found that COUPTFII suppressed intron 3-4 region-dependent luciferase activities.
More...

AA Sequence

MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDK      1 - 70
QQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCL     71 - 140
KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIE    141 - 210
NICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPM    211 - 280
SADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVR    281 - 350
SQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ          351 - 414
//

Text Mined References (71)

PMID Year Title
26261604 2015 High expression of COUP-TF II cooperated with negative Smad4 expression predicts poor prognosis in patients with colorectal cancer.
25687954 2015 Involvement of orphan nuclear receptor COUP-TFII in cadherin-6 and cadherin-11 regulation: implications in development and cancer.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25372459 2014 Regulation of the orphan nuclear receptor Nr2f2 by the DFNA15 deafness gene Pou4f3.
25129343 2014 High NR2F2 transcript level is associated with increased survival and its expression inhibits TGF-?-dependent epithelial-mesenchymal transition in breast cancer.
25032732 2014 COUP-TFII regulates metastasis of colorectal adenocarcinoma cells by modulating Snail1.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24702954 2014 Rare variants in NR2F2 cause congenital heart defects in humans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24176914 2013 COUP-TFII regulates human endometrial stromal genes involved in inflammation.
More...