Property Summary

NCBI Gene PubMed Count 76
PubMed Score 174.23
PubTator Score 89.68

Knowledge Summary

Patent (10,724)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.042 4.0e-03
astrocytic glioma -1.400 3.4e-02
atypical teratoid / rhabdoid tumor 2.100 1.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.480 8.9e-03
dermatomyositis 1.800 1.3e-03
Duchenne muscular dystrophy 1.331 1.6e-05
ependymoma -1.400 4.8e-02
glioblastoma 1.400 1.8e-02
group 4 medulloblastoma -1.100 1.2e-02
juvenile dermatomyositis 1.654 3.1e-11
lung adenocarcinoma -1.400 3.2e-09
malignant mesothelioma -1.900 1.3e-06
medulloblastoma, large-cell 1.400 2.1e-03
oligodendroglioma -1.300 3.7e-02
ovarian cancer -2.300 2.5e-05
pancreatic cancer 1.300 2.5e-04
pediatric high grade glioma 1.300 1.0e-02
Pick disease 1.100 4.9e-03
primary pancreatic ductal adenocarcinoma 1.128 9.4e-04
primary Sjogren syndrome 1.200 1.4e-02
primitive neuroectodermal tumor 1.300 1.5e-02
psoriasis -1.400 3.9e-05
pulmonary arterial hypertension -1.100 4.5e-02

 GO Component (1)

Protein-protein Interaction (6)

Gene RIF (54)

AA Sequence

MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDK      1 - 70
QQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCL     71 - 140
KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIE    141 - 210
NICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPM    211 - 280
SADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVR    281 - 350
SQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ          351 - 414
//

Text Mined References (81)

PMID Year Title