Property Summary

NCBI Gene PubMed Count 91
Grant Count 26
R01 Count 23
Funding $2,528,780.75
PubMed Score 85.65
PubTator Score 155.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.088 0.012
lung adenocarcinoma -1.300 0.004

Gene RIF (46)

PMID Text
26964624 CYP3A7*1C influences outcome are required.
26238215 CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.
25689036 Differences in the expression of nuclear receptors might determine the variability in CYP3A4 and CYP3A7 expression observed in foetal liver.
24168324 Only CYP1A1, CYP1B1, CYP3A4, CYP3A5 and CYP3A7 expressed in lymphocytes and monocytes.
23333304 HIV-1 Vif downregulates the expression of cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7) in Vif-expression T cells
23143891 Report CYP3A7 metabolism of inhaled glucocorticoids.
22277676 Report distinctive response patterns of HIF-1alpha, CYP3A4 and CYP3A7 to cobalt chloride in human fetal liver cells.
22253426 Expression and regulation of human fetal-specific CYP3A7 in mice
20637317 Data show that both isoforms of CYP3A7 did not metabolize the anti-cancer drug sorafenib, and suggest that CYP3A7 activity does not influence the effectiveness of this anti-cancer drug against HCC.
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTFDMECYKKYRK      1 - 70
VWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISIAEDEEWKRIRSLLSPTFTSG     71 - 140
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKL    141 - 210
LRFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQN    211 - 280
SKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTV    281 - 350
LQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFS    351 - 420
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIV    421 - 490
LKAESRDETVSGA                                                             491 - 503
//

Text Mined References (91)

PMID Year Title
26964624 2016 Cytochrome P450 Allele CYP3A7*1C Associates with Adverse Outcomes in Chronic Lymphocytic Leukemia, Breast, and Lung Cancer.
26238215 2015 Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.
25689036 2015 Expression of CYP3A4 and CYP3A7 in Human Foetal Tissues and its Correlation with Nuclear Receptors.
24168324 2014 Cytochrome P450 isoforms are differently up-regulated in aflatoxin B?-exposed human lymphocytes and monocytes.
23143891 2013 Metabolic pathways of inhaled glucocorticoids by the CYP3A enzymes.
22426036 2012 Genetic polymorphisms of the CYP3A4, CYP3A5, CYP3A7 and CYP1A2 among the Jordanian population.
22277676 2012 Effects of hypoxia-inducible factor-1? chemical stabilizer, CoCl(2) and hypoxia on gene expression of CYP3As in human fetal liver cells.
22253426 2012 Expression and regulation of human fetal-specific CYP3A7 in mice.
20637317 2011 Whole-cell biotransformation assay for investigation of the human drug metabolizing enzyme CYP3A7.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...