Property Summary

Ligand Count 1
NCBI Gene PubMed Count 97
PubMed Score 88.15
PubTator Score 155.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.300 3.9e-03
pancreatic ductal adenocarcinoma liver m... -1.088 1.2e-02

Protein-protein Interaction (4)

Gene RIF (52)

AA Sequence

MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTFDMECYKKYRK      1 - 70
VWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISIAEDEEWKRIRSLLSPTFTSG     71 - 140
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKL    141 - 210
LRFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQN    211 - 280
SKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTV    281 - 350
LQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFS    351 - 420
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIV    421 - 490
LKAESRDETVSGA                                                             491 - 503
//

Text Mined References (97)

PMID Year Title