Property Summary

NCBI Gene PubMed Count 400
Grant Count 278
R01 Count 196
Funding $19,958,733.56
PubMed Score 144.07
PubTator Score 527.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.633 0.000
malignant mesothelioma 1.100 0.000
psoriasis 1.700 0.000
osteosarcoma -1.476 0.000
Atopic dermatitis 1.300 0.000
primary pancreatic ductal adenocarcinoma 1.037 0.010
lung cancer -2.200 0.000
lung carcinoma -2.400 0.000
spina bifida 1.162 0.023
gastric carcinoma 1.200 0.017
mucosa-associated lymphoid tissue lympho... 1.187 0.010
ovarian cancer 1.200 0.000
Breast cancer -1.200 0.006
pancreatic cancer 1.100 0.011

Gene

PDB

3BPN   3BPO   5E4E   1IAR   1IRS   1ITE   3BPL  

Gene RIF (382)

PMID Text
26831416 investigated five SNPs (C-589T and C-33T of IL4, G+2044A of IL13, A+1902G of IL4Ralpha, and A+896G of TLR4) in patients with adult onset asthma to evaluate their role in manifestation and severity of asthma
26695670 There is no correlation between the Arg551Gln polymorphism in IL-4R gene and asthma predictive index results
26693492 genetic polymorphism is associated with autoimmune hepatitis in Brazilian children
26667837 IL4Rrs2107356 and IL8rs2227307 SNPs were associated with an increased risk of invasive aspergillosis.
26437765 Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels.
26306492 Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling.
26281177 Study results have demonstrated, that of all investigated polymorphic variants of genes IL4 (C-590T), IL4RA (150V), TNF (G-308A) and SLC11A1 (D543N) in patients with chronic liver diseases of various etiology
26187331 review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review]
26088753 analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review]
25867440 Studies indicate significant association between the interleukin-4receptor (IL-4R) Q576R polymorphism and the risk of asthma in the Chinese Han population.
More...

AA Sequence

MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSE      1 - 70
AHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLL     71 - 140
LTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNT    141 - 210
TWSEWSPSTKWHNSYREPFEQHLLLGVSVSCIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQ    211 - 280
DAQGSQWEKRSRGQEPAKCPHWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTV    281 - 350
LWPESISVVRCVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG    351 - 420
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPDNLTCTETPLV    421 - 490
IAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQ    491 - 560
HGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGEAGYKAFSSLLASSAVSPEKCGFGASSGEEG    561 - 630
YKPFQDLIPGCPGDPAPVPVPLFTFGLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQAT    631 - 700
DPLVDSLGSGIVYSALTCHLCGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVP    701 - 770
LEASLCPASLAPSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS                   771 - 825
//

Text Mined References (404)

PMID Year Title
26831416 2015 A preliminary study on the association of single nucleotide polymorphisms of interleukin 4 (IL4), IL13, IL4 receptor alpha (IL4R?) & Toll-like receptor 4 (TLR4) genes with asthma in Indian adults.
26695670 2015 [Correlations of IL-4R gene polymorphism and serum IgE levels with asthma predictive index].
26693492 2015 Autoimmune Hepatitis in Brazilian Children: IgE and Genetic Polymorphisms in Associated Genes.
26667837 2015 Polymorphisms in Host Immunity-Modulating Genes and Risk of Invasive Aspergillosis: Results from the AspBIOmics Consortium.
26437765 2015 Angiogenesis related genes NOS3, CD14, MMP3 and IL4R are associated to VEGF gene expression and circulating levels in healthy adults.
26306492 2015 Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling.
26281177 2015 [IMMUNOGENETICS AND PROGRESSION OF CHRONIC VIRAL HEPATITES].
26187331 2015 Commentary: IL-4 and IL-13 receptors and signaling.
26088753 2015 Targeting of IL-4 and IL-13 receptors for cancer therapy.
25867440 2015 Association of the IL-4R Q576R polymorphism and asthma in the Chinese Han population: a meta-analysis.
More...