Property Summary

Ligand Count 1
NCBI Gene PubMed Count 413
PubMed Score 150.85
PubTator Score 527.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.200 6.0e-03
Atopic dermatitis 1.300 9.8e-05
gastric carcinoma 1.200 1.7e-02
lung cancer -1.200 3.3e-02
lung carcinoma -2.400 1.5e-27
malignant mesothelioma 1.100 5.2e-06
mucosa-associated lymphoid tissue lympho... 1.187 1.0e-02
osteosarcoma -1.476 1.7e-04
ovarian cancer 1.200 4.1e-04
pancreatic cancer 1.100 1.1e-02
primary pancreatic ductal adenocarcinoma 1.037 9.5e-03
psoriasis 1.100 2.8e-08
spina bifida 1.162 2.3e-02
Waldenstrons macroglobulinemia -2.633 1.5e-04

Gene RIF (395)

AA Sequence

MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSE      1 - 70
AHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLL     71 - 140
LTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNT    141 - 210
TWSEWSPSTKWHNSYREPFEQHLLLGVSVSCIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQ    211 - 280
DAQGSQWEKRSRGQEPAKCPHWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTV    281 - 350
LWPESISVVRCVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG    351 - 420
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPDNLTCTETPLV    421 - 490
IAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQ    491 - 560
HGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGEAGYKAFSSLLASSAVSPEKCGFGASSGEEG    561 - 630
YKPFQDLIPGCPGDPAPVPVPLFTFGLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQAT    631 - 700
DPLVDSLGSGIVYSALTCHLCGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVP    701 - 770
LEASLCPASLAPSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS                   771 - 825
//

Text Mined References (417)

PMID Year Title