Property Summary

NCBI Gene PubMed Count 51
Grant Count 73
R01 Count 19
Funding $6,541,642.37
PubMed Score 104.99
PubTator Score 82.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.464 0.002
astrocytic glioma -1.900 0.011
ependymoma -2.400 0.002
oligodendroglioma -2.200 0.001
glioblastoma -2.100 0.000
osteosarcoma -1.955 0.001
medulloblastoma -2.200 0.000
adrenocortical carcinoma -1.893 0.000
pancreatic ductal adenocarcinoma liver m... -2.658 0.001
fibroadenoma -1.100 0.040
pediatric high grade glioma -1.600 0.004
pilocytic astrocytoma -2.000 0.000
Pick disease -1.300 0.001
ductal carcinoma in situ -1.300 0.005
invasive ductal carcinoma -1.400 0.020
acute myeloid leukemia -1.400 0.007

Synonym

Accession P24387 Q53F32 Q6FHT5 CRF-BP
Symbols CRFBP
CRF-BP

Gene

PANTHER Protein Class (1)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
588473 screening 1622 / 0 / 347546 uHTS identification of agonists of the CRF-binding protein and CRF-R2 receptor complex
588475 screening 2056 / 0 / 347112 uHTS identification of antagonists of the CRF-binding protein and CRF-R2 receptor complex
588476 summary 0 / 0 / 0 Summary assay for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex
588491 summary 0 / 0 / 0 Summary assay for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex
602180 confirmatory 408 / 0 / 1320 Dose Response confirmation of uHTS hits for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex
602473 confirmatory 482 / 0 / 1938 Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex
651639 confirmatory 180 / 0 / 193 Dose Response confirmation of uHTS hits for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format
651648 confirmatory 35 / 0 / 58 SAR analysis of small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format
651649 confirmatory 20 / 0 / 8 SAR analysis of small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format

Gene RIF (41)

PMID Text
26882083 These results suggest that the CRH and CRH-BP genes have no direct effect on Irritable bowel syndrome status.
26447706 Genetic polymorphism rs7718461 in the CRHBP gene showed significant association with overall pain severity during the year after motor vehicle collision.
24075295 Homozygosity for the CRHBP rs10055255 T allele was associated with significantly fewer post-ICU PTSD and depressive symptoms
23131710 Significant main effects on children's cortisol reactivity were found for loci on CRHR1 and CRHBP.
22984453 A significant association was observed in Blacks, Hispanics and Whites between birth weight and maternal CRH-BP single nucleotide polymorphism genotypes.
22286724 There was a significant association between the s/s homozygous genotype for the 5-HTTLPR polymorphism of SLC6A4 gene and restrained eating condition (p = 0.033
21978546 CRHBP variation may predispose, independently and additively, to suicidal behavior in individuals who have experienced childhood trauma.
21810631 interaction of CRHR1 SNP rs110402 and SNP rs3811939 predicts high risk of comorbid alcoholism in schizophrenic patients
21039637 results extend recent preclinical and clinical findings implicating the CRH-BP in stress-related alcoholism and confirm the role of the Asp40 allele of the OPRM1 gene in reward-driven alcohol phenotypes
21039637 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF      1 - 70
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF     71 - 140
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII    141 - 210
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT    211 - 280
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL                                281 - 322
//

Text Mined References (51)

PMID Year Title
26882083 2016 Associations between Single-Nucleotide Polymorphisms in Corticotropin-Releasing Hormone-Related Genes and Irritable Bowel Syndrome.
26447706 2016 CRHBP polymorphisms predict chronic pain development following motor vehicle collision.
24075295 2014 A pilot investigation of the association of genetic polymorphisms regulating corticotrophin-releasing hormone with posttraumatic stress and depressive symptoms in medical-surgical intensive care unit survivors.
23131710 2013 Corticotropin-releasing hormone system polymorphisms are associated with children's cortisol reactivity.
22984453 2012 Variation in the maternal corticotrophin releasing hormone-binding protein (CRH-BP) gene and birth weight in Blacks, Hispanics and Whites.
22286724 2011 [CRF-BP and SLC6A4 gene polymorphisms among restrained eaters].
21978546 2012 Two HPA axis genes, CRHBP and FKBP5, interact with childhood trauma to increase the risk for suicidal behavior.
21810631 2011 Prediction of the risk of comorbid alcoholism in schizophrenia by interaction of common genetic variants in the corticotropin-releasing factor system.
21624661 2011 Corticotropin-releasing factor binding protein enters the regulated secretory pathway in neuroendocrine cells and cortical neurons.
21039637 2011 Stress-induced and cue-induced craving for alcohol in heavy drinkers: Preliminary evidence of genetic moderation by the OPRM1 and CRH-BP genes.
More...