Property Summary

NCBI Gene PubMed Count 68
PubMed Score 300.24
PubTator Score 274.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 7.9e-04
astrocytic glioma -1.500 1.9e-02
atypical teratoid / rhabdoid tumor -1.400 6.9e-06
ependymoma -1.300 4.6e-02
gastric cancer 1.100 4.4e-04
Gaucher disease type 1 -1.500 1.2e-02
glioblastoma 1.200 3.7e-05
group 4 medulloblastoma -1.200 7.4e-04
lung cancer 1.100 3.4e-02
lung carcinoma 1.400 9.5e-35
medulloblastoma, large-cell -2.100 8.8e-06
oligodendroglioma -1.400 4.6e-02
osteosarcoma -1.197 2.6e-04
primitive neuroectodermal tumor -1.200 2.6e-04
tuberculosis -1.100 7.5e-05

Synonym

Accession P24386 A1L4D2 O43732
Symbols TCD
GGTA
REP-1
DXS540
HSD-32

Gene

CHM

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (41)

AA Sequence

MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVS      1 - 70
DSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQKNHALVTSANSTEAADSAFLP     71 - 140
TEDESLSTMSCEMLTEQTPSSDPENALEVNGAEVTGEKENHCDDKTCVPSTSAEDMSENVPIAEDTTEQP    141 - 210
KKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRAD    211 - 280
VFNSKQLTMVEKRMLMKFLTFCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVMHSIAMTSETASS    281 - 350
TIDGLKATKNFLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII    351 - 420
DQFGQRIISEHFLVEDSYFPENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAEEPGTFAVRVI    421 - 490
ELCSSTMTCMKGTYLVHLTCTSSKTAREDLESVVQKLFVPYTEMEIENEQVEKPRILWALYFNMRDSSDI    491 - 560
SRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICPNEDFCPPPPNPEDIILDGDSLQPEASESSA    561 - 630
IPEANSETFKESTNLGNLEESSE                                                   631 - 653
//

Text Mined References (70)

PMID Year Title